BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0734 (436 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y09479-1|CAA70686.1| 364|Homo sapiens G protein-coupled recepto... 30 3.0 U80811-1|AAC51139.1| 364|Homo sapiens lysophosphatidic acid rec... 30 3.0 U78192-1|AAC00530.1| 364|Homo sapiens Edg-2 receptor protein. 30 3.0 BC036034-1|AAH36034.1| 364|Homo sapiens endothelial differentia... 30 3.0 BC030615-1|AAH30615.1| 364|Homo sapiens EDG2 protein protein. 30 3.0 AY322546-1|AAP84359.1| 364|Homo sapiens endothelial differentia... 30 3.0 AL442064-2|CAI13010.1| 364|Homo sapiens endothelial differentia... 30 3.0 AL442064-1|CAI13009.1| 182|Homo sapiens endothelial differentia... 30 3.0 AL157881-4|CAH69979.1| 364|Homo sapiens endothelial differentia... 30 3.0 BC027482-1|AAH27482.1| 183|Homo sapiens Ras homolog enriched in... 29 6.9 AY509932-1|AAS80166.1| 181|Homo sapiens RHEBL1c protein. 29 6.9 AY327412-1|AAP92804.1| 183|Homo sapiens Ras homolog enriched in... 29 6.9 AK098663-1|BAC05370.1| 183|Homo sapiens protein ( Homo sapiens ... 29 6.9 >Y09479-1|CAA70686.1| 364|Homo sapiens G protein-coupled receptor Edg-2 protein. Length = 364 Score = 30.3 bits (65), Expect = 3.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 57 ASSSHVTVISKNSTTPSNKP*CLYNCKRIVYFGRDRKH 170 A S+ + VIS+ T N+P C YN ++ R KH Sbjct: 3 AISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKH 40 >U80811-1|AAC51139.1| 364|Homo sapiens lysophosphatidic acid receptor homolog protein. Length = 364 Score = 30.3 bits (65), Expect = 3.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 57 ASSSHVTVISKNSTTPSNKP*CLYNCKRIVYFGRDRKH 170 A S+ + VIS+ T N+P C YN ++ R KH Sbjct: 3 AISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKH 40 >U78192-1|AAC00530.1| 364|Homo sapiens Edg-2 receptor protein. Length = 364 Score = 30.3 bits (65), Expect = 3.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 57 ASSSHVTVISKNSTTPSNKP*CLYNCKRIVYFGRDRKH 170 A S+ + VIS+ T N+P C YN ++ R KH Sbjct: 3 AISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKH 40 >BC036034-1|AAH36034.1| 364|Homo sapiens endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, protein. Length = 364 Score = 30.3 bits (65), Expect = 3.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 57 ASSSHVTVISKNSTTPSNKP*CLYNCKRIVYFGRDRKH 170 A S+ + VIS+ T N+P C YN ++ R KH Sbjct: 3 AISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKH 40 >BC030615-1|AAH30615.1| 364|Homo sapiens EDG2 protein protein. Length = 364 Score = 30.3 bits (65), Expect = 3.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 57 ASSSHVTVISKNSTTPSNKP*CLYNCKRIVYFGRDRKH 170 A S+ + VIS+ T N+P C YN ++ R KH Sbjct: 3 AISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKH 40 >AY322546-1|AAP84359.1| 364|Homo sapiens endothelial differentiation G-protein-coupled receptor 2 protein. Length = 364 Score = 30.3 bits (65), Expect = 3.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 57 ASSSHVTVISKNSTTPSNKP*CLYNCKRIVYFGRDRKH 170 A S+ + VIS+ T N+P C YN ++ R KH Sbjct: 3 AISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKH 40 >AL442064-2|CAI13010.1| 364|Homo sapiens endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, protein. Length = 364 Score = 30.3 bits (65), Expect = 3.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 57 ASSSHVTVISKNSTTPSNKP*CLYNCKRIVYFGRDRKH 170 A S+ + VIS+ T N+P C YN ++ R KH Sbjct: 3 AISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKH 40 >AL442064-1|CAI13009.1| 182|Homo sapiens endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, protein. Length = 182 Score = 30.3 bits (65), Expect = 3.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 57 ASSSHVTVISKNSTTPSNKP*CLYNCKRIVYFGRDRKH 170 A S+ + VIS+ T N+P C YN ++ R KH Sbjct: 3 AISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKH 40 >AL157881-4|CAH69979.1| 364|Homo sapiens endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, protein. Length = 364 Score = 30.3 bits (65), Expect = 3.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 57 ASSSHVTVISKNSTTPSNKP*CLYNCKRIVYFGRDRKH 170 A S+ + VIS+ T N+P C YN ++ R KH Sbjct: 3 AISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKH 40 >BC027482-1|AAH27482.1| 183|Homo sapiens Ras homolog enriched in brain like 1 protein. Length = 183 Score = 29.1 bits (62), Expect = 6.9 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 221 FHIQPIQFSFNVHGYYRVFSVTTEINYAFAIIKAL 117 + I P F VHGY V+SVT+ ++F +I++L Sbjct: 67 YSILPYSFIIGVHGYVLVYSVTS--LHSFQVIESL 99 >AY509932-1|AAS80166.1| 181|Homo sapiens RHEBL1c protein. Length = 181 Score = 29.1 bits (62), Expect = 6.9 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 221 FHIQPIQFSFNVHGYYRVFSVTTEINYAFAIIKAL 117 + I P F VHGY V+SVT+ ++F +I++L Sbjct: 65 YSILPYSFIIGVHGYVLVYSVTS--LHSFQVIESL 97 >AY327412-1|AAP92804.1| 183|Homo sapiens Ras homolog enriched in brain-like 1 protein. Length = 183 Score = 29.1 bits (62), Expect = 6.9 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 221 FHIQPIQFSFNVHGYYRVFSVTTEINYAFAIIKAL 117 + I P F VHGY V+SVT+ ++F +I++L Sbjct: 67 YSILPYSFIIGVHGYVLVYSVTS--LHSFQVIESL 99 >AK098663-1|BAC05370.1| 183|Homo sapiens protein ( Homo sapiens cDNA FLJ25797 fis, clone TST07046. ). Length = 183 Score = 29.1 bits (62), Expect = 6.9 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 221 FHIQPIQFSFNVHGYYRVFSVTTEINYAFAIIKAL 117 + I P F VHGY V+SVT+ ++F +I++L Sbjct: 67 YSILPYSFIIGVHGYVLVYSVTS--LHSFQVIESL 99 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,448,887 Number of Sequences: 237096 Number of extensions: 1104906 Number of successful extensions: 1439 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1439 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3487985734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -