BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0734 (436 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81478-1|CAB03932.1| 199|Caenorhabditis elegans Hypothetical pr... 29 1.5 Z69302-10|CAA93267.1| 295|Caenorhabditis elegans Hypothetical p... 28 2.5 Z47074-3|CAA87376.1| 295|Caenorhabditis elegans Hypothetical pr... 28 2.5 AF008590-1|AAB63299.1| 295|Caenorhabditis elegans paraquat resp... 28 2.5 AC024776-20|AAK68473.2| 460|Caenorhabditis elegans Nuclear horm... 28 3.4 Z74030-19|CAA98449.2| 841|Caenorhabditis elegans Hypothetical p... 27 7.8 Z72508-10|CAA96644.2| 841|Caenorhabditis elegans Hypothetical p... 27 7.8 >Z81478-1|CAB03932.1| 199|Caenorhabditis elegans Hypothetical protein C31G12.1 protein. Length = 199 Score = 29.1 bits (62), Expect = 1.5 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = -1 Query: 313 NKLSMVPCRASSVSTLNVFILENHSTYSGYVSISNPFNSHLMFTVITECFLSRPK*TMR 137 N LS+V C ++ N +I +NHS + + F +H+ T T + P+ T R Sbjct: 80 NSLSLVACGFFTIICANQYICDNHSWIVSFSTFF--FTAHVRLTNATISSIELPEKTRR 136 >Z69302-10|CAA93267.1| 295|Caenorhabditis elegans Hypothetical protein F40F8.7 protein. Length = 295 Score = 28.3 bits (60), Expect = 2.5 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +3 Query: 54 NASSSHVTVISKNSTTPSNKP*CLYNCK--RIVYFGRDRKHSV 176 N+ S HVT+ +N N P C + + R ++F ++ +H + Sbjct: 174 NSVSYHVTIYHRNPPIKCNVPNCQFTTREARYIHFHKNYRHGI 216 >Z47074-3|CAA87376.1| 295|Caenorhabditis elegans Hypothetical protein F40F8.7 protein. Length = 295 Score = 28.3 bits (60), Expect = 2.5 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +3 Query: 54 NASSSHVTVISKNSTTPSNKP*CLYNCK--RIVYFGRDRKHSV 176 N+ S HVT+ +N N P C + + R ++F ++ +H + Sbjct: 174 NSVSYHVTIYHRNPPIKCNVPNCQFTTREARYIHFHKNYRHGI 216 >AF008590-1|AAB63299.1| 295|Caenorhabditis elegans paraquat responsive protein protein. Length = 295 Score = 28.3 bits (60), Expect = 2.5 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +3 Query: 54 NASSSHVTVISKNSTTPSNKP*CLYNCK--RIVYFGRDRKHSV 176 N+ S HVT+ +N N P C + + R ++F ++ +H + Sbjct: 174 NSVSYHVTIYHRNPPIKCNVPNCQFTTREARYIHFHKNYRHGI 216 >AC024776-20|AAK68473.2| 460|Caenorhabditis elegans Nuclear hormone receptor familyprotein 274 protein. Length = 460 Score = 27.9 bits (59), Expect = 3.4 Identities = 12/27 (44%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = -1 Query: 85 EITVTC-DDDALTLTRYSNCICRYCYL 8 E+T C +T S CICRYC L Sbjct: 67 EVTYKCLKGGTCVITNESRCICRYCRL 93 >Z74030-19|CAA98449.2| 841|Caenorhabditis elegans Hypothetical protein F28H7.10a protein. Length = 841 Score = 26.6 bits (56), Expect = 7.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 309 NYLWYHAVRAQCQH*MYSFW 250 NYL +HA+ QC YS W Sbjct: 477 NYLQWHAIDTQCHLMYYSAW 496 >Z72508-10|CAA96644.2| 841|Caenorhabditis elegans Hypothetical protein F28H7.10a protein. Length = 841 Score = 26.6 bits (56), Expect = 7.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 309 NYLWYHAVRAQCQH*MYSFW 250 NYL +HA+ QC YS W Sbjct: 477 NYLQWHAIDTQCHLMYYSAW 496 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,405,325 Number of Sequences: 27780 Number of extensions: 187320 Number of successful extensions: 449 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 735312162 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -