BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0731 (717 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 26 0.27 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.4 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.5 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 22 5.7 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 26.2 bits (55), Expect = 0.27 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 33 ASTPRASTAWPGARTL-SASLRARSTPPSSSGALTSHPSTRSLR 161 +++P AS A+PG RTL LR + P ++ S + SL+ Sbjct: 8 STSPSASEAFPGGRTLVEKGLRKQGVPREATKITLSSLAKGSLK 51 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -3 Query: 154 DRVLGWL-VNAPDDDGGVE 101 D+VL +L NA DD+GG+E Sbjct: 1060 DKVLTFLGANAQDDEGGLE 1078 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -3 Query: 154 DRVLGWL-VNAPDDDGGVE 101 D+VL +L NA DD+GG+E Sbjct: 1060 DKVLTFLGANAQDDEGGLE 1078 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.0 bits (47), Expect = 2.5 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -3 Query: 112 GGVERA-RSDALRVRAPGHAVDARG 41 GG E A R+ A VRA G A ARG Sbjct: 268 GGEEEAERAPAPAVRAAGDAAAARG 292 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.8 bits (44), Expect = 5.7 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -3 Query: 214 GLVVDPSQTGYLTLGMGILNDRVLGWLVN 128 GL V+ S T + +G+G + DRVL LVN Sbjct: 275 GLTVNKS-TAH-AVGVGNIYDRVLSELVN 301 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,608 Number of Sequences: 336 Number of extensions: 3571 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -