BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0729 (757 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||... 27 2.2 SPBC21D10.05c |ucp3|soc2|GTPase activating protein Ucp3 |Schizos... 26 6.7 SPAC23A1.04c |mnl1||alpha mannosidase-like protein|Schizosacchar... 26 6.7 SPCC1235.05c |fft2||fun thirty related protein Fft2|Schizosaccha... 26 6.7 SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c... 25 8.8 >SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 27.5 bits (58), Expect = 2.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 21 GAICLVNSGNERDSSLLNRRRYLGVRGLVSRNSLTT 128 G + ++N G E D L N RYL V L N++TT Sbjct: 56 GEVFVLNDGGEVDLDLGNYERYLNVT-LTHDNNITT 90 >SPBC21D10.05c |ucp3|soc2|GTPase activating protein Ucp3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 601 Score = 25.8 bits (54), Expect = 6.7 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -3 Query: 536 YGNLVTTFTSSK*SSLVNFPTTPTAVKPPRVGPKTSLNHSIGS 408 YG +T+S SS+V P P P + + N+S+ S Sbjct: 321 YGIDSNLYTNSNSSSIVQNPLQPARTGPAAINYNYTTNYSVSS 363 >SPAC23A1.04c |mnl1||alpha mannosidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 787 Score = 25.8 bits (54), Expect = 6.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -2 Query: 561 LMILPQVPLRKPCYDFYFL*MIKFGQLP 478 L++ ++ L K + +YF +KFGQLP Sbjct: 337 LVLAGELELAKKMHLYYFSIYLKFGQLP 364 >SPCC1235.05c |fft2||fun thirty related protein Fft2|Schizosaccharomyces pombe|chr 3|||Manual Length = 1284 Score = 25.8 bits (54), Expect = 6.7 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = -1 Query: 754 CACSTQQY*IYN----VSSQIQYRRDKRAREREKSDKR*KLRTIECMHAYIYINK 602 C S Q IYN + Q RRD + +R K+D+ +++ H + + K Sbjct: 796 CKLSENQLEIYNRYAALQKNQQLRRDDKRNKRSKNDEESDGKSLSAGHVLMQLRK 850 >SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 796 Score = 25.4 bits (53), Expect = 8.8 Identities = 8/30 (26%), Positives = 20/30 (66%) Frame = +1 Query: 598 FIYLYIYTHAYIRSFLIFIVYPISHALARV 687 F+YLY+ +I FL+++++ + ++A + Sbjct: 196 FLYLYVLFTYFISIFLLYVLFSSTKSIADI 225 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,876,846 Number of Sequences: 5004 Number of extensions: 58164 Number of successful extensions: 140 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -