BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0729 (757 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical p... 28 8.2 AL132851-1|CAB60411.1| 403|Caenorhabditis elegans Hypothetical ... 28 8.2 >Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical protein Y69H2.14 protein. Length = 338 Score = 27.9 bits (59), Expect = 8.2 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 6/38 (15%) Frame = -2 Query: 321 DNCKPQSPARRSFSGLPGPLGQ----GE--HADSFSVA 226 ++C+ +PAR+ G PGP GQ GE H+D+ S A Sbjct: 190 NDCQTCAPARQGAPGPPGPAGQPGQPGEPGHSDTSSTA 227 >AL132851-1|CAB60411.1| 403|Caenorhabditis elegans Hypothetical protein Y53H1B.1 protein. Length = 403 Score = 27.9 bits (59), Expect = 8.2 Identities = 17/62 (27%), Positives = 25/62 (40%) Frame = -3 Query: 587 TYHTQYNTR**SFRRFPYGNLVTTFTSSK*SSLVNFPTTPTAVKPPRVGPKTSLNHSIGS 408 TY+ N F + + V+T+ S+ +N PPR GP S S S Sbjct: 230 TYNKDNNVAYAQVNTFKFADKVSTYFQCAVSTCMNTEGMCDGKTPPRCGPAGSFRSSSSS 289 Query: 407 SD 402 +D Sbjct: 290 ND 291 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,247,162 Number of Sequences: 27780 Number of extensions: 344646 Number of successful extensions: 972 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 856 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 970 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -