BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0725 (509 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1D4.01 ||SPAC1F3.11|sequence orphan|Schizosaccharomyces pomb... 29 0.31 SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 27 2.2 SPBC530.12c |pdf1||palmitoyl protein thioesterase-dolichol pyrop... 25 6.6 SPBC646.02 |cwf11||complexed with Cdc5 protein Cwf11 |Schizosacc... 25 6.6 SPAC4F8.06 |||mitochondrial ribosomal protein subunit S12|Schizo... 25 8.7 SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 25 8.7 SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyc... 25 8.7 >SPAC1D4.01 ||SPAC1F3.11|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 285 Score = 29.5 bits (63), Expect = 0.31 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = -2 Query: 313 QEQLLRE*DLLGSIRDVSIGNYMTDVPKTQATLEREKRSSRFQCK 179 + +R+ LG+IR+V +G TDV + +R+K+ +R + K Sbjct: 194 EHSFIRDAAALGAIREVDLGIISTDVDNLKNGRKRQKKRARMKEK 238 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 26.6 bits (56), Expect = 2.2 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 157 YILYDMKICIGNANFFSLFLTWL 225 YIL + + +G ++F S+FL WL Sbjct: 567 YILLNENLFVGQSSFKSVFLKWL 589 >SPBC530.12c |pdf1||palmitoyl protein thioesterase-dolichol pyrophosphate phosphatase fusion 1|Schizosaccharomyces pombe|chr 2|||Manual Length = 603 Score = 25.0 bits (52), Expect = 6.6 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = +1 Query: 271 GLSPTNLIREATALELLGL-LW 333 G SPTNLI +A +LGL +W Sbjct: 142 GCSPTNLICKAVVHSILGLGIW 163 >SPBC646.02 |cwf11||complexed with Cdc5 protein Cwf11 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1284 Score = 25.0 bits (52), Expect = 6.6 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 85 PIDIYEINAPPTLRYKFGNSRYGSE 11 P+DI +++ P R +GNS + E Sbjct: 1061 PLDIKTVDSSPNKRLDYGNSGFAHE 1085 >SPAC4F8.06 |||mitochondrial ribosomal protein subunit S12|Schizosaccharomyces pombe|chr 1|||Manual Length = 146 Score = 24.6 bits (51), Expect = 8.7 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = -1 Query: 419 RPFQFHQDRWASKGSARRGGIC*QLLERFQRRPNNSRAVASRMR 288 RP + ++ A +GS R G+C ++ ++PN++ +R+R Sbjct: 34 RPEKTNKQSVALEGSPFRRGVCTRVFTVKPKKPNSAVRKVARVR 77 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 24.6 bits (51), Expect = 8.7 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 278 LNPRCQYWKLHDGRSKNTSHVRKR 207 LN Q+W H RSK + + KR Sbjct: 2615 LNSPRQFWAYHGSRSKKIADIVKR 2638 >SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 24.6 bits (51), Expect = 8.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 289 DLLGSIRDVSIGNYMTDVPKTQATLE 212 D+ ++R VS GN++ VP TLE Sbjct: 363 DIYEAVRAVSPGNFILSVPFPAKTLE 388 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,201,918 Number of Sequences: 5004 Number of extensions: 43707 Number of successful extensions: 89 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 204242806 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -