BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0725 (509 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0804 - 7774631-7775152,7775985-7776083 28 3.8 09_04_0660 - 19286653-19287271,19287791-19287916,19288016-192882... 28 5.0 >08_01_0804 - 7774631-7775152,7775985-7776083 Length = 206 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 353 SKSHPFWLSLCSPTCPGETGKASGPPVILQ*LKKKKKNSRGGP 481 S S P + CSP+C G+ G A V ++ K ++ GGP Sbjct: 92 SSSSPISETPCSPSCSGKHGGAEEDQVDVRREDKARRARVGGP 134 >09_04_0660 - 19286653-19287271,19287791-19287916,19288016-19288221, 19288417-19288549,19288632-19288713,19288906-19289035, 19289187-19289279,19289391-19289510,19289594-19289660, 19290079-19290137,19290719-19290943 Length = 619 Score = 27.9 bits (59), Expect = 5.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 383 CSPTCPGETGKASGPPVILQ*LKKKKKN 466 C+ TCPG +G SGP + +K + N Sbjct: 95 CASTCPGPSGSDSGPVICSAPIKYQLAN 122 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,801,921 Number of Sequences: 37544 Number of extensions: 301659 Number of successful extensions: 608 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1095026320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -