BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0725 (509 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66500-4|CAA91305.2| 630|Caenorhabditis elegans Hypothetical pr... 27 6.0 >Z66500-4|CAA91305.2| 630|Caenorhabditis elegans Hypothetical protein T05C12.4 protein. Length = 630 Score = 27.5 bits (58), Expect = 6.0 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -3 Query: 189 SNANFHVI*YVLHFFLLFK*VDDLTAYLVLS--GYWS 85 SN+N + I Y++ FF+ + V +AY VL+ G+WS Sbjct: 87 SNSNTYAI-YLMLFFISWLIVTSASAYFVLAGIGFWS 122 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,244,373 Number of Sequences: 27780 Number of extensions: 253948 Number of successful extensions: 531 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 531 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 988489374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -