BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0723 (625 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24H6.11c |||sulfate transporter |Schizosaccharomyces pombe|c... 29 0.41 SPAC323.01c |||mitochondrial NADH kinase |Schizosaccharomyces po... 29 0.72 SPCC737.03c |||conserved eukaryotic protein|Schizosaccharomyces ... 27 1.7 SPAC19A8.15 |trp2||tryptophan synthase|Schizosaccharomyces pombe... 25 6.7 SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizos... 25 8.9 SPAC2F7.09c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 8.9 >SPAC24H6.11c |||sulfate transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 958 Score = 29.5 bits (63), Expect = 0.41 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +3 Query: 129 VPNREEASERSPSPRTVVPKMAHRHQPSEKYCGAISEGKLHTDFLPD 269 +P REE S + P + V + PS+K G IS K++ F D Sbjct: 105 LPEREEHSSQLPPAQNQVLPFQSLNAPSKKLRGRISLSKIYQFFFDD 151 Score = 25.4 bits (53), Expect = 6.7 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 34 LAYSSTIFPRSPPTHLALFADDTTVYYSS 120 L+Y +FP S P L AD +YY S Sbjct: 176 LSYGLILFPISDPLFKNLGADGLAIYYVS 204 >SPAC323.01c |||mitochondrial NADH kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 361 Score = 28.7 bits (61), Expect = 0.72 Identities = 23/70 (32%), Positives = 28/70 (40%), Gaps = 1/70 (1%) Frame = +1 Query: 22 HPSYLAYSST-IFPRSPPTHLALFADDTTVYYSSRNKSLIAKKLQSAALALGQWFRKWRI 198 HPS A T I P S LF D + + NKS + +L LG RI Sbjct: 261 HPSINALLLTPICPNSLSFRPVLFPDTFKISIETSNKSRVRPQLSIDGRPLGLTDIGQRI 320 Query: 199 DINPAKSTAV 228 DI K A+ Sbjct: 321 DITSVKDNAI 330 >SPCC737.03c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 615 Score = 27.5 bits (58), Expect = 1.7 Identities = 18/64 (28%), Positives = 26/64 (40%) Frame = +1 Query: 16 SSHPSYLAYSSTIFPRSPPTHLALFADDTTVYYSSRNKSLIAKKLQSAALALGQWFRKWR 195 SSHP Y AY + P + F + Y S L A ++ LG W +K + Sbjct: 118 SSHPDYQAYEKAL-PEYKKSIEEKFPIVCSECYDSVQDQLDANDYEAKNQVLGYWLQKSK 176 Query: 196 IDIN 207 +N Sbjct: 177 EQLN 180 >SPAC19A8.15 |trp2||tryptophan synthase|Schizosaccharomyces pombe|chr 1|||Manual Length = 697 Score = 25.4 bits (53), Expect = 6.7 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 433 PMICKRSKMSLRNKVTLYK 489 P ICK ++++L+N +TL K Sbjct: 63 PTICKGNEIALKNNITLEK 81 >SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1338 Score = 25.0 bits (52), Expect = 8.9 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 13 LSSHPSYLAYS-STIFPRSPPTHLALFADDTTVYYSSR 123 + +HP + + + TI PP F+ + TVY+ SR Sbjct: 952 IKAHPFFKSVNWDTILEEDPPFVPKPFSPEDTVYFDSR 989 >SPAC2F7.09c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 491 Score = 25.0 bits (52), Expect = 8.9 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +1 Query: 343 LGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKR 450 LG++ +M + H ++ D+ +LGR+ P++C R Sbjct: 177 LGISSKYAMLYTSHSFNLVDK---LLGRINPLLCSR 209 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,482,975 Number of Sequences: 5004 Number of extensions: 50468 Number of successful extensions: 130 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -