BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0723 (625 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g32170.1 68415.m03932 expressed protein ;supported by cDNA GI... 30 1.4 At3g06070.1 68416.m00694 expressed protein 28 5.8 At1g15770.1 68414.m01892 expressed protein 27 7.7 >At2g32170.1 68415.m03932 expressed protein ;supported by cDNA GI:20259498 Length = 504 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = -2 Query: 591 PAKAGL*GLEGVYVCAGRVSEHHTRVSHDGPYASFVKCHLVPKGH 457 PA AG+ EG +C G E + SH G + + V C + H Sbjct: 365 PASAGI--TEGFSMCGGDFVEVYNESSHAGMWDAVVTCFFIDTAH 407 >At3g06070.1 68416.m00694 expressed protein Length = 151 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +3 Query: 168 PRTVVPKMAHRHQPSEKYCGAISEGKLHTDFLPD*EEESHTPDYSL*TTHTLGQE 332 PR+ P+ H H P +K +G+ F+P + H D +L T + QE Sbjct: 79 PRSSQPRRKHNHHPHQK-----KQGRFIGSFIPKQQFPHHGHDNNLTTLNNNNQE 128 >At1g15770.1 68414.m01892 expressed protein Length = 332 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -2 Query: 546 AGRVSEHHTRVSHDGPYASFVKCHLVPKGHFTPLTDHGVESTEN 415 AG V +R S + KCHL + T DH E+++N Sbjct: 265 AGSVPGKGSRASFGVDLVAMTKCHLQERNFMTQDGDHEKEASDN 308 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,484,170 Number of Sequences: 28952 Number of extensions: 285159 Number of successful extensions: 614 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 614 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -