BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0720 (605 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g26932.1 68416.m03370 double-stranded RNA-binding domain (DsR... 27 7.3 At2g28260.1 68415.m03430 cyclic nucleotide-regulated ion channel... 27 9.6 >At3g26932.1 68416.m03370 double-stranded RNA-binding domain (DsRBD)-containing protein contains Pfam profile PF00035: Double-stranded RNA binding motif Length = 301 Score = 27.5 bits (58), Expect = 7.3 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 510 KSMAQEAVHRAGLDLHHQNTRRSTAIAQAHIP 605 K++ QE HRAGLDL + RS HIP Sbjct: 31 KNLLQETAHRAGLDLPVYTSVRS---GPGHIP 59 >At2g28260.1 68415.m03430 cyclic nucleotide-regulated ion channel, putative (CNGC15) similar to cyclic nucleotide and calmodulin-regulated ion channel (cngc6) GI:4581207 from [Arabidopsis thaliana] Length = 678 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 323 EWR-RQRERDDVPPHRQRPPSLRAPHAAPRAQQWTSERDVE 442 EWR R+ + + HRQ PP LR +W + R V+ Sbjct: 401 EWRIRRTDTEQWMHHRQLPPELRQAVRKYDQYKWLATRGVD 441 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,385,309 Number of Sequences: 28952 Number of extensions: 89034 Number of successful extensions: 281 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 281 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -