BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0718 (699 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 2.8 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 2.8 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 23 2.8 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 6.4 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 6.4 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 163 VDIVFNSIFEGRLAS*YLRCSHIRHVSWV 77 VD++F F L Y+ C + VSWV Sbjct: 233 VDLLFKREFSYYLIQIYIPCCMLVIVSWV 261 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 163 VDIVFNSIFEGRLAS*YLRCSHIRHVSWV 77 VD++F F L Y+ C + VSWV Sbjct: 233 VDLLFKREFSYYLIQIYIPCCMLVIVSWV 261 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 23.0 bits (47), Expect = 2.8 Identities = 16/69 (23%), Positives = 26/69 (37%) Frame = -3 Query: 589 TNAPGRLIL*ATTKLPAVHASHCWCAHAHGQTSRAVPSPPHGTADGMLSAATTYGTILFP 410 T +P L ++ AV A+ A H S SP H + S A + ++P Sbjct: 31 TTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSGSSASTSPAARTTSSMYP 90 Query: 409 GGANKCLHY 383 + H+ Sbjct: 91 YVSAAAAHH 99 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +1 Query: 361 FSKITSLCNVNIYWRPPEIISC 426 F+ T +C + W P +I++C Sbjct: 152 FTTYTPVCEYDHTWWPYDILNC 173 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 396 LLAPPGNNIVPYVVAADSMPSAVP 467 +L PP +N V V + D + A+P Sbjct: 434 ILTPPSSNPVSPVPSPDPLDLAIP 457 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,253 Number of Sequences: 438 Number of extensions: 4863 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -