BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0716 (755 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 29 4.1 SB_56913| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 149 RENIARRDSVRDKVRTIDYTLNIFELIFFLYAVRAVC 259 R+N R S+R VR + + +F + L A+R++C Sbjct: 440 RQNSVNRRSIRSSVRVLGAMILLFVFCWVLSAIRSLC 476 >SB_56913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1603 Score = 28.3 bits (60), Expect = 7.1 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 5/90 (5%) Frame = -2 Query: 409 IESVSHKQRYVIGFVTIQLLISRANKETNLKWRRRMAITRSHSKLLLSLVAHGAYCIQ-- 236 + VSH R + QL + NLK R+R + RS K L + AH + + Sbjct: 620 VTPVSHPDRIPLQMALTQL----ESLADNLKERKRESELRSRVKQLDTATAHLSKPLSSG 675 Query: 235 KKY---QFKYIKCIIYGSDFVAHTVSTRYV 155 +Y Q +++C+I G D + HT R + Sbjct: 676 NRYFIRQDDFVQCVIEG-DTIVHTKRRRLI 704 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,021,240 Number of Sequences: 59808 Number of extensions: 310982 Number of successful extensions: 500 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 499 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -