Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0716
         (755 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF099914-9|AAC68759.2|  273|Caenorhabditis elegans Math (meprin-...    29   3.6  

>AF099914-9|AAC68759.2|  273|Caenorhabditis elegans Math
           (meprin-associated traf homology)domain containing
           protein 18 protein.
          Length = 273

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 16/51 (31%), Positives = 26/51 (50%)
 Frame = -2

Query: 370 FVTIQLLISRANKETNLKWRRRMAITRSHSKLLLSLVAHGAYCIQKKYQFK 218
           FV  + + S   +  N+ WR  + I++ H +L + L    A C  KKY+ K
Sbjct: 157 FVRGEQVYSDIEEHYNIPWR--ITISKCHERLGIYLYCKKAVCEGKKYEVK 205


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,798,927
Number of Sequences: 27780
Number of extensions: 244522
Number of successful extensions: 394
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 386
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 393
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1798543458
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)