BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0716 (755 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 25 0.77 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.8 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 23 3.1 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 23 3.1 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 23 3.1 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 5.4 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 5.4 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 5.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 5.4 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 5.4 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 5.4 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 5.4 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 5.4 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 5.4 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 5.4 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 5.4 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 5.4 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 5.4 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 5.4 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 5.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 5.4 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 25.0 bits (52), Expect = 0.77 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -1 Query: 482 LSWIAARSAHLPMTLIKGNKKTNIH*IGQS*TTLCNWFCY 363 L W+ A LP LI GN+ T G S +C F Y Sbjct: 164 LVWLGAACISLPPLLIMGNEHTYSE-TGPSHCVVCQNFFY 202 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 1.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 380 CNWFCYNTTSYKSR 339 C W C+N T Y+ R Sbjct: 605 CCWHCFNCTQYQIR 618 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 347 YKKLYCNKTNYITLFMTDRFNE 412 YKKLYCN NY L+ + E Sbjct: 96 YKKLYCN--NYKKLYYNINYIE 115 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 347 YKKLYCNKTNYITLFMTDRFNE 412 YKKLYCN NY L+ + E Sbjct: 96 YKKLYCN--NYKKLYYNINYIE 115 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 347 YKKLYCNKTNYITLFMTDRFNE 412 YKKLYCN NY L+ + E Sbjct: 96 YKKLYCN--NYRKLYYNINYIE 115 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = -3 Query: 564 VNSSK*NTRL*SINDKNKNKVIGYFELPLLDRCSVGSSTND 442 VN+++ N L +++D+N+N + L ++ +G++ ND Sbjct: 367 VNNTQRNEYLLALSDRNQNVLNNDLNLEHVNFQILGANVND 407 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 197 KKYATSSNSLRSRTHGF 213 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 197 KKYATSSNSLRSRTHGF 213 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 208 KKYATSSNSLRSRTHGF 224 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 208 KKYATSSNSLRSRTHGF 224 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 208 KKYATSSNSLRSRTHGF 224 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 208 KKYATSSNSLRSRTHGF 224 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 208 KKYATSSNSLRSRTHGF 224 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 208 KKYATSSNSLRSRTHGF 224 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 197 KKYATSSNSLRSRTHGF 213 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 208 KKYATSSNSLRSRTHGF 224 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 208 KKYATSSNSLRSRTHGF 224 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 208 KKYATSSNSLRSRTHGF 224 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 208 KKYATSSNSLRSRTHGF 224 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 208 KKYATSSNSLRSRTHGF 224 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 584 KSYDNSKSTVRSKTRGF 534 K Y S +++RS+T GF Sbjct: 208 KKYATSSNSLRSRTHGF 224 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,613 Number of Sequences: 438 Number of extensions: 3152 Number of successful extensions: 31 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -