SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0713
         (712 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    23   2.9  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       22   6.6  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   8.7  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = -3

Query: 59   QNTPTTPPPPSCGR 18
            Q  P  PPPPS G+
Sbjct: 1353 QQPPPPPPPPSSGQ 1366


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +1

Query: 175 SICSSVTTQPDR 210
           S+C+S TT PD+
Sbjct: 632 SMCTSTTTSPDK 643


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = -3

Query: 674 AGHVHERNAATGGLCLKYPTFGFSTEYAFR 585
           AG VH R+     +  +Y     + EYA R
Sbjct: 87  AGSVHSRDVNVRAVVAQYYDTDVNKEYAIR 116


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 218,045
Number of Sequences: 438
Number of extensions: 5260
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21926700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -