BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0711 (708 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68006-7|CAA91995.2| 783|Caenorhabditis elegans Hypothetical pr... 28 5.7 AF497831-1|AAM18109.1| 783|Caenorhabditis elegans putative Na-H... 28 5.7 Z83216-3|CAB05674.2| 232|Caenorhabditis elegans Hypothetical pr... 28 7.5 >Z68006-7|CAA91995.2| 783|Caenorhabditis elegans Hypothetical protein K09C8.1 protein. Length = 783 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 4/41 (9%) Frame = +1 Query: 25 GYFFIKD*IF--IVYLDFMPRIY--YSLCQLIPDNAYSLKD 135 G+FF+ D I +L+F +++ Y L +I ++AYSLKD Sbjct: 148 GFFFVGDATHASIKFLEFKSKVFFFYLLPPIILESAYSLKD 188 >AF497831-1|AAM18109.1| 783|Caenorhabditis elegans putative Na-H exchanger isoform 7 protein. Length = 783 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 4/41 (9%) Frame = +1 Query: 25 GYFFIKD*IF--IVYLDFMPRIY--YSLCQLIPDNAYSLKD 135 G+FF+ D I +L+F +++ Y L +I ++AYSLKD Sbjct: 148 GFFFVGDATHASIKFLEFKSKVFFFYLLPPIILESAYSLKD 188 >Z83216-3|CAB05674.2| 232|Caenorhabditis elegans Hypothetical protein C08F11.3 protein. Length = 232 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 144 FQYILKTVCVVWDQLTQTIVN 82 F+YIL T+C VW + TI N Sbjct: 139 FEYILLTICFVWTLIIITIRN 159 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,365,912 Number of Sequences: 27780 Number of extensions: 318853 Number of successful extensions: 546 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -