BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0710 (397 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071028-1|AAL48650.1| 663|Drosophila melanogaster RE11035p pro... 27 6.8 AE014134-629|AAF51091.1| 663|Drosophila melanogaster CG8852-PA ... 27 6.8 >AY071028-1|AAL48650.1| 663|Drosophila melanogaster RE11035p protein. Length = 663 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -2 Query: 132 RCTFVEF*SNNSLAPLRESHGNLSSINFRYGRPGHHNMSQ 13 R V +S P+ HGN+SS YG P + SQ Sbjct: 451 RIMHVRINGTDSSIPVPHPHGNVSSFTVLYGNPVELHRSQ 490 >AE014134-629|AAF51091.1| 663|Drosophila melanogaster CG8852-PA protein. Length = 663 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -2 Query: 132 RCTFVEF*SNNSLAPLRESHGNLSSINFRYGRPGHHNMSQ 13 R V +S P+ HGN+SS YG P + SQ Sbjct: 451 RIMHVRINGTDSSIPVPHPHGNVSSFTVLYGNPVELHRSQ 490 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,349,176 Number of Sequences: 53049 Number of extensions: 236923 Number of successful extensions: 273 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 273 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1128794130 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -