BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0709 (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) 260 5e-70 SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_33442| Best HMM Match : AAA (HMM E-Value=0) 83 1e-16 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 72 5e-13 SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) 70 1e-12 SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45627| Best HMM Match : AAA (HMM E-Value=0) 39 0.003 SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_19460| Best HMM Match : AAA (HMM E-Value=0) 35 0.049 SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.049 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.065 SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) 34 0.085 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) 32 0.34 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 31 0.80 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_28977| Best HMM Match : AAA (HMM E-Value=0) 30 1.8 SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) 29 2.4 SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_36974| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 29 4.2 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 29 4.2 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_41890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 5.6 SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) 28 5.6 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 28 5.6 SB_46136| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) 28 7.4 SB_32475| Best HMM Match : IWS1_C (HMM E-Value=0) 28 7.4 SB_29265| Best HMM Match : OmpH (HMM E-Value=3) 28 7.4 SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) 28 7.4 SB_45970| Best HMM Match : rve (HMM E-Value=1.7e-11) 28 7.4 SB_38518| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 27 9.8 SB_27802| Best HMM Match : Filament (HMM E-Value=0.2) 27 9.8 SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_7056| Best HMM Match : Seryl_tRNA_N (HMM E-Value=8.1) 27 9.8 SB_4536| Best HMM Match : Krr1 (HMM E-Value=4) 27 9.8 >SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 260 bits (638), Expect = 5e-70 Identities = 140/182 (76%), Positives = 148/182 (81%), Gaps = 1/182 (0%) Frame = +3 Query: 3 DKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENT 182 DK+IW DGEE + EEVLRM TDEIVSR RLLDNEI KEN+ Sbjct: 7 DKAIWGDGEE-MGEEVLRMSTDEIVSRARLLDNEI---------------------KENS 44 Query: 183 EKIKVNKTLPYLVSNVIELLDVDPQE-EEEDGAVVDLDSQRKGKCAVIKTSTRQTYFLPV 359 EKIKVNKTLPYLVSNVIELLDVDPQ+ EEDGA VDLDSQRKGKCAVIKTSTRQTYFLPV Sbjct: 45 EKIKVNKTLPYLVSNVIELLDVDPQDYAEEDGANVDLDSQRKGKCAVIKTSTRQTYFLPV 104 Query: 360 IGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGXLDKQIQ 539 IGLV+ E L PGDLVGVNKDSYLILE LPAEYD+RVKAMEVDERPTEQYSDIG LD+QIQ Sbjct: 105 IGLVEPENLTPGDLVGVNKDSYLILEKLPAEYDSRVKAMEVDERPTEQYSDIGGLDQQIQ 164 Query: 540 EL 545 E+ Sbjct: 165 EM 166 >SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 85.4 bits (202), Expect = 3e-17 Identities = 52/175 (29%), Positives = 91/175 (52%) Frame = +3 Query: 111 IMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDL 290 +M+ E ++ L+ Q +K +E K+ + P V N+ E++D Sbjct: 268 LMEEEFIQNQERLKPQEEKHEEERSKVDDLRGTPMSVGNLEEIID--------------- 312 Query: 291 DSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVK 470 D+ A++ TS +++ ++ VD + L+PG V +N + ++ L + D V Sbjct: 313 DNH-----AIVSTSVGSEHYVSILSFVDKDLLEPGCTVLLNHKVHAVVGVLSDDADPMVT 367 Query: 471 AMEVDERPTEQYSDIGXLDKQIQELIEAVVLPMTHKEKFVNLGLPPTPKEFFLFG 635 M++++ P E Y+DIG LD QIQE+ E+V LP+TH E + +G+ P PK L+G Sbjct: 368 VMKLEKAPQESYADIGGLDTQIQEIKESVELPLTHPELYEEMGIKP-PKGVILYG 421 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 83.4 bits (197), Expect = 1e-16 Identities = 37/107 (34%), Positives = 66/107 (61%) Frame = +3 Query: 318 VIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPT 497 ++ ++T Y++ ++ +D E LKP V ++K S +++ LP E D+ + + +E+P Sbjct: 101 IVASTTGSNYYVRILSTIDKELLKPSASVALHKHSNALVDILPPEADSSIAMLTNEEKPN 160 Query: 498 EQYSDIGXLDKQIQELIEAVVLPMTHKEKFVNLGLPPTPKEFFLFGP 638 Y++IG +D Q QE+ EAV LP+TH E + +G+ P P+ L+GP Sbjct: 161 VSYAEIGGMDIQKQEIREAVELPLTHFELYKQIGIDP-PRGVLLYGP 206 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 71.7 bits (168), Expect = 5e-13 Identities = 36/77 (46%), Positives = 48/77 (62%) Frame = +3 Query: 408 VNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGXLDKQIQELIEAVVLPMTHKEKF 587 V+++ Y I LP + D V M+V+E+P YSDIG +QI +L E V P+ H E+F Sbjct: 51 VDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIDKLREVVETPLLHPERF 110 Query: 588 VNLGLPPTPKEFFLFGP 638 VNLG+ P PK LFGP Sbjct: 111 VNLGIEP-PKGVLLFGP 126 >SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) Length = 779 Score = 70.1 bits (164), Expect = 1e-12 Identities = 39/107 (36%), Positives = 57/107 (53%) Frame = +3 Query: 318 VIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPT 497 ++K + Y + VD KLK G V ++ + I+ LP E D V M ++ Sbjct: 72 IVKATNGPRYVVGCRRQVDKAKLKQGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGN 131 Query: 498 EQYSDIGXLDKQIQELIEAVVLPMTHKEKFVNLGLPPTPKEFFLFGP 638 YSD+G L +QI+EL E + LP+T+ E F +G+ P PK LFGP Sbjct: 132 ISYSDVGGLSEQIRELREVIELPLTNPELFQRVGIAP-PKGCLLFGP 177 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 56.4 bits (130), Expect = 2e-08 Identities = 41/125 (32%), Positives = 61/125 (48%), Gaps = 8/125 (6%) Frame = +3 Query: 288 LDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGD----LVGVNKDSYLILETLP--- 446 L++QR A ++ + L G E +KP D LV V+ + +++ Sbjct: 96 LEAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKGID 155 Query: 447 -AEYDARVKAMEVDERPTEQYSDIGXLDKQIQELIEAVVLPMTHKEKFVNLGLPPTPKEF 623 AE D V M V++ P Y +G LDKQI+E+ E + LP+ H E F LG+ PK Sbjct: 156 MAEVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGI-DQPKGV 214 Query: 624 FLFGP 638 L+GP Sbjct: 215 LLYGP 219 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = +3 Query: 504 YSDIGXLDKQIQELIEAVVLPMTHKEKFVNLGLPPTPKEFFLFGPS 641 + IG L QIQ + E + +P+T+ E F G+PP P+ L+GPS Sbjct: 255 FQSIGGLKTQIQAVREMIEMPLTNPELFTAYGVPP-PRGILLYGPS 299 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/51 (37%), Positives = 29/51 (56%) Frame = +3 Query: 486 ERPTEQYSDIGXLDKQIQELIEAVVLPMTHKEKFVNLGLPPTPKEFFLFGP 638 E P +SD+G + ++L EAV P+ H E F LG+ P P+ ++GP Sbjct: 530 EVPKVHWSDVGGNEMIKRKLKEAVEWPLKHPEAFQRLGIRP-PRGILMYGP 579 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 39.1 bits (87), Expect = 0.003 Identities = 28/90 (31%), Positives = 43/90 (47%) Frame = +3 Query: 369 VDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGXLDKQIQELI 548 +DAE L D + V+ D + + R +EV P + DIG L+ +EL Sbjct: 270 IDAEVL---DSLAVSMDDFRYAMGVSNPSALRETVVEV---PNVSWDDIGGLEGVKRELQ 323 Query: 549 EAVVLPMTHKEKFVNLGLPPTPKEFFLFGP 638 E V P+ H +KF+ G+ P+ K +GP Sbjct: 324 ELVQYPVEHPDKFLKFGMTPS-KGVLFYGP 352 >SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 35.5 bits (78), Expect = 0.037 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Frame = +3 Query: 468 KAME--VDERPTEQYSDIGXLDKQIQELIEAVVLPMTHKEKFVNLGLPPTPKEFFLFGP 638 K ME V +PT ++ D+G L+ Q L +A+ P+ H E F +GL P+ L+GP Sbjct: 470 KGMEGVVRLQPT-RWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGL-RRPRGVLLYGP 526 >SB_19460| Best HMM Match : AAA (HMM E-Value=0) Length = 340 Score = 35.1 bits (77), Expect = 0.049 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = +3 Query: 489 RPTEQYSDIGXLDKQIQELIEAVVLPMTHKEKFVNLGLPPTPKEFFLFGP 638 +PT ++ D+G L+ Q L +A+ P+ H E F +GL P+ L+GP Sbjct: 8 QPT-RWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGL-RRPRGVLLYGP 55 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 35.1 bits (77), Expect = 0.049 Identities = 27/112 (24%), Positives = 54/112 (48%), Gaps = 2/112 (1%) Frame = +3 Query: 9 SIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKI--MKSEVMRISHELQAQNDKIKENT 182 S W+D +L EV ++ D+ + +++D+E ++ ++S + + L D +K + Sbjct: 2603 SDWKDQASSLQSEVAQLKKDKAAAMHKVIDSEEQMIQLRSRLYKTEDSLVRNQDTVKLLS 2662 Query: 183 EKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKCAVIKTSTR 338 K N L + + L V E ++ +VD + + K KC V+ T T+ Sbjct: 2663 ---KENTDLRVEIERLRSRLSVYASETAKE--IVDGNGEGKAKCGVV-TKTK 2708 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 34.7 bits (76), Expect = 0.065 Identities = 20/84 (23%), Positives = 46/84 (54%), Gaps = 2/84 (2%) Frame = +3 Query: 66 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNK-TLPYLVSNVIELL 242 + + S R +NEI +K+ + R+ EL++ +++ ++EKI ++ + L ++ + Sbjct: 105 ESVTSELRGRENEIAELKTSIGRLESELRSLKSELQNSSEKISEDEHEISQLKNDKARCM 164 Query: 243 -DVDPQEEEEDGAVVDLDSQRKGK 311 ++ + E+ + VVDL RK + Sbjct: 165 QELRDEREKSNKLVVDLQKTRKAQ 188 >SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) Length = 1197 Score = 34.3 bits (75), Expect = 0.085 Identities = 28/100 (28%), Positives = 47/100 (47%), Gaps = 4/100 (4%) Frame = +3 Query: 3 DKSIWEDGEEALSEEVLRMPT--DEIVSRTRLLDNEIKIMKSE--VMRISHELQAQNDKI 170 D+ WE+ ++ L M T DE + + E K E + + ++ AQ +I Sbjct: 391 DREEWEEEQKRLDRAWYDMDTGYDETQNPFADVSEEYTKKKEEKLIKKAVKKMSAQQRQI 450 Query: 171 KENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDL 290 ++ + + N+ L S V++ LDVD EEE+ A V L Sbjct: 451 NKDNDMWETNRML---TSGVVQKLDVDEDFEEENEAKVHL 487 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 33.9 bits (74), Expect = 0.11 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +3 Query: 402 VGVN-KDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGXLDKQIQELIEAVVLPMTHK 578 V +N KD L+ L A + + A ++ P + D+G LD +E+++ + LP+ H Sbjct: 779 VSINFKDFQEALDALQASHADAIGAPKI---PDISWKDVGGLDSVKEEILDTIQLPLLHP 835 Query: 579 EKF 587 E F Sbjct: 836 ELF 838 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 33.1 bits (72), Expect = 0.20 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +3 Query: 123 EVMRISHELQAQNDKIKENTEKIK-VNKTLPYLVSNVIELLD 245 E+ + +EL+ Q + IKEN EK+K K + L +IEL D Sbjct: 612 EITELENELEEQREIIKENEEKLKEKEKEIEKLKKKIIELSD 653 >SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 590 Score = 32.3 bits (70), Expect = 0.34 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = +3 Query: 93 LDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVI---ELLDVDPQ 257 ++NE K+ ++ V ++H+L + D E E I++ PY + +V+ EL+ V P+ Sbjct: 191 VENEEKVYEALVRWVNHDLSQRRDLFPELLELIRLPLVSPYYLVDVVEKEELMTVSPR 248 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 31.1 bits (67), Expect = 0.80 Identities = 25/105 (23%), Positives = 53/105 (50%), Gaps = 2/105 (1%) Frame = +3 Query: 3 DKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENT 182 ++ + E+ E EE +++ + + E+++M + + HE + +++IKE Sbjct: 2911 EEELLEEVEVQRVEEGASHDLEDVPALKESYEEEVEVM---AVGLKHEERVNDEEIKEKD 2967 Query: 183 EKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDL--DSQRKGK 311 EKI +++ N+I+ L+ +EE E AV + +R+GK Sbjct: 2968 EKIHLDE------ENIIQDLEETFEEELEVSAVETSKNEDERRGK 3006 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 30.7 bits (66), Expect = 1.1 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 2/98 (2%) Frame = +3 Query: 18 EDGEEALSEEVL--RMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKI 191 EDG E L E++ R E+ R + L+ E +++ +V + ++ + KIK+ EK+ Sbjct: 408 EDGTE-LEEKIRSQRNRITELERRVKELEKEKNLLEQQVKTMKNKSDDDDKKIKDLNEKV 466 Query: 192 KVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRK 305 +V + L N E+ + E + + DL + K Sbjct: 467 RVLE--KQLKENDAEIQGLKDDNERLEDELEDLSTTIK 502 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = +3 Query: 66 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLD 245 DE++ + L ++ ++ EV ++ EL+ + ++TEK+ N + ++EL Sbjct: 716 DELMKQNESLRKKVSKLEDEVRFLNDELREADSSSIKDTEKL--NAEIREFKKKIVELEK 773 Query: 246 -VDPQEEE 266 VD QEEE Sbjct: 774 LVDDQEEE 781 >SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1531 Score = 30.7 bits (66), Expect = 1.1 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 9/109 (8%) Frame = +3 Query: 42 EEVLRMPTDEIVSR---TRLLDNEIKIMKSEVMRISHELQAQND------KIKENTEKIK 194 EE LR +E+ R LDNE+ ++++ +L+ D ++ E E+ K Sbjct: 909 EEKLRRTEEELKDRDGQVAKLDNELTKLQNDFQDTITQLKTLEDLLDTSKRVVEEKEQ-K 967 Query: 195 VNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKCAVIKTSTRQ 341 V + L +V EL D +E+DG + +LD K IK Q Sbjct: 968 VTELDKLLNESVDELQQKDKSLKEKDGKLAELDQALKESRKEIKNREAQ 1016 >SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 30.7 bits (66), Expect = 1.1 Identities = 30/136 (22%), Positives = 62/136 (45%), Gaps = 1/136 (0%) Frame = +3 Query: 138 SHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVV-DLDSQRKGKC 314 S + + K +E++E + + + ++ E + + +EEEED ++ D D K Sbjct: 363 SEDEEKPEHKPREDSEDVTSRTSSDFTLATESEEEEEEEEEEEEDDELIGDPDVLEALKT 422 Query: 315 AVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERP 494 A R+ L ++ DA+ + D + +D ++ ++P Y+ K + ++ P Sbjct: 423 A----KARENEDLLLLA-ADADGNEESDYT-ITEDEGSVVSSIPTFYEGEQKLEDDEDEP 476 Query: 495 TEQYSDIGXLDKQIQE 542 T + S LD+Q E Sbjct: 477 TSRTST--ALDEQPSE 490 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +3 Query: 165 KIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQR 302 K+K ++ + NKT + N +E D +P+E EED V D++R Sbjct: 510 KLKSKMKRSEKNKTEELVAVNKVETDDDNPEETEEDSGNVS-DTER 554 >SB_28977| Best HMM Match : AAA (HMM E-Value=0) Length = 442 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 480 VDERPTEQYSDIGXLDKQIQELIEAVVLPMTHKEKFVNLGLP 605 V E+P ++SDI L+ + L EAV+LP+ F P Sbjct: 88 VMEKPNVKWSDIAGLESAKEALKEAVILPIKFPHLFTGKRTP 129 >SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) Length = 597 Score = 29.5 bits (63), Expect = 2.4 Identities = 20/41 (48%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Frame = +3 Query: 450 EYDARVKAMEVDERPTEQYSDIGXL---DKQ-IQELIEAVV 560 EYD R+KA E +QY D+ L DKQ I L EAVV Sbjct: 523 EYDKRIKAFEESGDKPQQYVDLTRLRCDDKQTIVALAEAVV 563 >SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +3 Query: 27 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEK 188 + A+ E++ D VS R+ +NE+++ KSE + +Q K + E+ Sbjct: 121 QTAIQLEIVNFNDDSFVSGNRMSNNEVRVTKSESLSSPSNSYSQAFKSNNSREE 174 >SB_36974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 28.7 bits (61), Expect = 4.2 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +3 Query: 234 ELLDVDPQEEEEDGAVVD 287 +++D+ PQ+EEEDG V++ Sbjct: 527 DIVDLQPQDEEEDGEVIE 544 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +3 Query: 39 SEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKE 176 S E DE+V R L +E+K +K E + ++++ N K+++ Sbjct: 700 SLETCSKERDELVESNRNLGSELKALKKENEELVSQVESLNQKVEQ 745 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 28.7 bits (61), Expect = 4.2 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +3 Query: 234 ELLDVDPQEEEEDGAVVD 287 +++D+ PQ+EEEDG V++ Sbjct: 982 DIVDLQPQDEEEDGEVIE 999 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 28.7 bits (61), Expect = 4.2 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +3 Query: 234 ELLDVDPQEEEEDGAVVD 287 +++D+ PQ+EEEDG V++ Sbjct: 22 DIVDLQPQDEEEDGEVIE 39 >SB_41890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +3 Query: 96 DNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIE 236 D +K + SE ++ EL Q DKI KIK+ P + ++IE Sbjct: 104 DQPMKKLGSEFETVTGELLTQLDKISRGVRKIKLVSGDPRDIQSLIE 150 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/69 (24%), Positives = 30/69 (43%) Frame = +3 Query: 6 KSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTE 185 KS+ + G+ + DE+ R L+ E+K +KSE + Q N ++ Sbjct: 224 KSLKKGGDLLFPGASYKRKLDEVAGRLDELEREVKRLKSETCQTKMTCQPCNHQLLMVGP 283 Query: 186 KIKVNKTLP 212 + + TLP Sbjct: 284 TVPIPPTLP 292 >SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) Length = 1127 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +3 Query: 18 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKI 170 ++ E L + LR E S+ + LD+E+ + + ++ HELQ + +I Sbjct: 910 QEAEFELKLDDLRADIQERDSQIKELDSEMAEVTENIAKLQHELQGKGQEI 960 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 28.3 bits (60), Expect = 5.6 Identities = 38/168 (22%), Positives = 69/168 (41%), Gaps = 8/168 (4%) Frame = +3 Query: 27 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKI----- 191 E L++ L M + + L+N ++ +++++ S Q D + NT+++ Sbjct: 822 ESNLAKRQLEMDNTHHKNLIKTLENRVQELQTQIDTESRSNQQARDMLVRNTKEMERLEF 881 Query: 192 ---KVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKCAVIKTSTRQTYFLPVI 362 +V L V ELL +P ++ D+D RK KT + T + Sbjct: 882 KNTEVKAQLEAAEKRVHELLSKEPSSDQ------DIDKMRKETEEKFKTDLQDT----EL 931 Query: 363 GLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQY 506 L DAE K DL + + L E + A +A+ + TE++ Sbjct: 932 KLKDAE-AKIKDLETQLEQAKLHAEQFKSMSGANDEALREVNKSTEEF 978 >SB_46136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +3 Query: 57 MPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDK-IKENTEKIKVNKTLPYLVSNVI 233 M TD+ L+ ++ M SE++R+ + A++DK ++ E I+ L+ ++ Sbjct: 76 METDQANQSVSDLEGIVQSMGSEILRLQSLVSAEDDKMLRYKVENIRRKHNYIPLIMEML 135 Query: 234 ELL 242 +LL Sbjct: 136 KLL 138 >SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +3 Query: 12 IWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHEL 149 I E +E ++ R+ EI+S+T +L ++IK + VMRI E+ Sbjct: 196 IIEGKKEFKLADLGRVTLKEIISKTSVLVSDIKGSRESVMRIPMEI 241 >SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) Length = 961 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +3 Query: 63 TDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVN 200 T+++V + +EI I E ++ HE++ + +I TEK+ V+ Sbjct: 376 TNKVVHEVKGKVSEISIKTDETNKVVHEVKGKVSEISIKTEKMAVD 421 >SB_32475| Best HMM Match : IWS1_C (HMM E-Value=0) Length = 768 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 174 ENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGA 278 E ++ + ++T P N +E V P+ EEEDGA Sbjct: 56 EGEKEDEASETSPRGSENSVESRSVSPKNEEEDGA 90 >SB_29265| Best HMM Match : OmpH (HMM E-Value=3) Length = 218 Score = 27.9 bits (59), Expect = 7.4 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = +3 Query: 237 LLDVDPQEEE--EDGAVVDLDSQ--RKGKCAVIKTSTRQTYFLPVIGLVD 374 L D D E E +D VD++++ KGK K+S + Y PV+ L D Sbjct: 25 LCDTDAPEAEVVDDEPEVDVETETEEKGKAETKKSSEPEEYTPPVVALED 74 >SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) Length = 1491 Score = 27.9 bits (59), Expect = 7.4 Identities = 37/193 (19%), Positives = 87/193 (45%), Gaps = 10/193 (5%) Frame = +3 Query: 36 LSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNK-TLP 212 L EE+ + + + TR + E K++ + + ++ EL + KE + K +K L Sbjct: 1005 LKEELTKAEKERTETATRA-EREKKLLTTTIQALTKELDKVKQQKKEMKKSFKRSKGDLQ 1063 Query: 213 YLVSNVIELLDVDPQEEEEDGAVVDLDSQR-KGKCAVIK--------TSTRQTYFLPVIG 365 N + + ++ +E G ++ + R K K IK +S + Y + + Sbjct: 1064 NSFENERKQFEDSLEKSKEVGKMLAEEVMREKLKNETIKYEERINEMSSQMEAYEMKIEQ 1123 Query: 366 LVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGXLDKQIQEL 545 L + K + G+L + ++S + +ETL + D +++E E + + + ++ ++ L Sbjct: 1124 LQNKFKAEKGELEDLLQESRVEMETLIEKQDEFRESLE-QEYQRKLHKEKQNIESTLESL 1182 Query: 546 IEAVVLPMTHKEK 584 + + H+++ Sbjct: 1183 RQEISRLRDHRKQ 1195 >SB_45970| Best HMM Match : rve (HMM E-Value=1.7e-11) Length = 717 Score = 27.9 bits (59), Expect = 7.4 Identities = 33/128 (25%), Positives = 53/128 (41%), Gaps = 3/128 (2%) Frame = +3 Query: 243 DVDPQEEEEDGAVVDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDS 422 D D +EE++DGA S + + + R+ Y+ + D E +P V KD Sbjct: 398 DDDDEEEDDDGATEKNSSGQYTRLIHVLQEKRRKYYQLIQAEEDEETEQP-IRTNVEKD- 455 Query: 423 YLILETLPAEYDARVKAMEVDERPTEQYSDIGXLDKQI---QELIEAVVLPMTHKEKFVN 593 L+ R++ + D R + SD+ D I Q + + +P +EK Sbjct: 456 ---LQDAKDRDWLRIEKQKAD-REAKPLSDLPGTDAIITSPQIKDKEIPIPKALQEKSSA 511 Query: 594 LGLPPTPK 617 L PP PK Sbjct: 512 LLPPPQPK 519 >SB_38518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1399 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +3 Query: 240 LDVDPQEEEEDGAVVDLDSQRKGKCAVIKTS-TRQTY 347 +D P+E + DGAVV++ S +G V ++S +RQ+Y Sbjct: 477 MDEVPEEMDSDGAVVNIQSAMRGH--VTRSSLSRQSY 511 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 27.5 bits (58), Expect = 9.8 Identities = 26/109 (23%), Positives = 51/109 (46%), Gaps = 1/109 (0%) Frame = +3 Query: 156 QNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKCAVIKTS- 332 Q+DK+ + K++ + +++++ + + +DP EE +L S K + + K Sbjct: 313 QDDKVAQAKAKLQHAEKASDVLTSMEKEMGLDPSTAEEK--TKNLTSVLKDEMSKFKDLI 370 Query: 333 TRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAME 479 +Q + EKL D+ G N LI+E A+Y A+ +A + Sbjct: 371 NKQDDSVKKEKFEKLEKLAEEDVKGTNDVMKLIVELEVAKYFAKQRARQ 419 >SB_27802| Best HMM Match : Filament (HMM E-Value=0.2) Length = 528 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/51 (23%), Positives = 29/51 (56%) Frame = +3 Query: 42 EEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIK 194 E+ + +EI+ + IK+ + + R+ HE+Q +ND + ++ +++K Sbjct: 114 EDEIAQEKEEILELKNKHSDSIKLAE-DTNRLLHEVQRKNDSLAKDMKRVK 163 >SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/34 (38%), Positives = 24/34 (70%), Gaps = 3/34 (8%) Frame = +3 Query: 96 DNEIKIMKSEVMRISHELQ---AQNDKIKENTEK 188 D++I+++KSE+ + S E+Q AQ D++K +K Sbjct: 274 DDQIQMLKSELEKASTEMQGIAAQVDEVKSQADK 307 >SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = +3 Query: 18 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKE 176 + E+ + R P D V ++++ E+K+ K+ + H ++ D+ KE Sbjct: 309 QKSEKEVDASSERAPKDNKVRKSKIKTEELKVPKALEREVGHAKTSKKDESKE 361 >SB_7056| Best HMM Match : Seryl_tRNA_N (HMM E-Value=8.1) Length = 94 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +3 Query: 93 LDNEIK----IMKSEVMRISHELQAQNDKIKENTEKIK 194 LD E++ +M E R++ ELQAQ DK+ ++++ Sbjct: 22 LDKELEWRRDVMNKEYTRLASELQAQEDKVLNMKQQVQ 59 >SB_4536| Best HMM Match : Krr1 (HMM E-Value=4) Length = 246 Score = 27.5 bits (58), Expect = 9.8 Identities = 20/75 (26%), Positives = 39/75 (52%) Frame = +3 Query: 81 RTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQE 260 R R L+ ++ MK E +A+ K+ ++ K V+ +P+ N++ELL DP++ Sbjct: 93 RKRQLNILLEKMKGERSLRQQLNKARKSKMLKSRSKRLVDLGVPH---NLLELLPEDPED 149 Query: 261 EEEDGAVVDLDSQRK 305 + +V+L R+ Sbjct: 150 AMPEEIIVELGRIRE 164 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,938,953 Number of Sequences: 59808 Number of extensions: 351453 Number of successful extensions: 1215 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 1103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1210 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -