BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0709 (642 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 25 0.47 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 25 0.47 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 25 0.47 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 24 1.1 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 24 1.1 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.4 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 24 1.4 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 5.8 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 5.8 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 25.4 bits (53), Expect = 0.47 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 9/82 (10%) Frame = +3 Query: 27 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMK---------SEVMRISHELQAQNDKIKEN 179 +E+ + + + DEI+ RLL+N K + +E+ R+ + A + K + Sbjct: 22 DESYTSKFDNINVDEILHSDRLLNNYFKCLMDEGRCTAEGNELKRVLPDALATDCKKCTD 81 Query: 180 TEKIKVNKTLPYLVSNVIELLD 245 ++ + K + +LV N EL D Sbjct: 82 KQREVIKKVIKFLVENKPELWD 103 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 25.4 bits (53), Expect = 0.47 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 9/82 (10%) Frame = +3 Query: 27 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMK---------SEVMRISHELQAQNDKIKEN 179 +E+ + + + DEI+ RLL+N K + +E+ R+ + A + K + Sbjct: 22 DESYTSKFDNINVDEILHSDRLLNNYFKCLMDEGRCTAEGNELKRVLPDALATDCKKCTD 81 Query: 180 TEKIKVNKTLPYLVSNVIELLD 245 ++ + K + +LV N EL D Sbjct: 82 KQREVIKKVIKFLVENKPELWD 103 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 25.4 bits (53), Expect = 0.47 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 9/82 (10%) Frame = +3 Query: 27 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMK---------SEVMRISHELQAQNDKIKEN 179 +E+ + + + DEI+ RLL+N K + +E+ R+ + A + K + Sbjct: 22 DESYTSKFDNINVDEILHSDRLLNNYFKCLMDEGRCTAEGNELKRVLPDALATDCKKCTD 81 Query: 180 TEKIKVNKTLPYLVSNVIELLD 245 ++ + K + +LV N EL D Sbjct: 82 KQREVIKKVIKFLVENKPELWD 103 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 Query: 412 LTPTKSPGLSFSASTKPMTGK 350 L+ S GLS S STKP T K Sbjct: 538 LSENLSSGLSISDSTKPETSK 558 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 312 CAVIKTSTRQTYFLPVIGLVDAEKLKPGDLV 404 C V+ ST Y + V+GL A P D++ Sbjct: 154 CVVLACSTATVYVMSVVGLSKAPAQIPVDVL 184 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.8 bits (49), Expect = 1.4 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +3 Query: 165 KIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDS 296 +IK+ E ++ + L + + + + + +EEEE+ +DLDS Sbjct: 291 EIKKEVEDMEYDDIKTELSTGMNDDIPPETEEEEENDKKLDLDS 334 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +3 Query: 126 VMRISHELQAQNDKIKENTEKIKVNKTLPYLVSN 227 + R + E+ AQND+ + +K+ + LP+ V + Sbjct: 334 LQRQNLEMVAQNDRTLQMIAGMKIKEELPHFVGS 367 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 630 IKRTPLGWVEGRDSQISPCVSLATLQLQLIPVSVY 526 I RTP+ + D Q P V+ T + L PV+ + Sbjct: 316 IDRTPIEIINSGDVQDVPWVTGVTSEEGLYPVAEF 350 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 630 IKRTPLGWVEGRDSQISPCVSLATLQLQLIPVSVY 526 I RTP+ + D Q P V+ T + L PV+ + Sbjct: 316 IDRTPIEIINSGDVQDVPWVTGVTSEEGLYPVAEF 350 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,231 Number of Sequences: 438 Number of extensions: 3037 Number of successful extensions: 15 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -