BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0707 (710 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H1.09c |||vacuolar amino acid transporter |Schizosaccharomy... 38 0.001 SPBC1685.07c |||amino acid transporter |Schizosaccharomyces pomb... 37 0.002 SPBC17G9.13c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 26 6.1 SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schi... 26 6.1 SPCC737.03c |||conserved eukaryotic protein|Schizosaccharomyces ... 26 6.1 SPBC18E5.13 ||SPBC23G7.03|translation initiation factor |Schizos... 26 6.1 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 25 8.1 SPAC29E6.02 |prp3|SPAC30.06|U4/U6 x U5 tri-snRNP complex subunit... 25 8.1 >SPAC3H1.09c |||vacuolar amino acid transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 656 Score = 38.3 bits (85), Expect = 0.001 Identities = 19/60 (31%), Positives = 36/60 (60%) Frame = +2 Query: 368 NTSSFGALAHLLKASLGSGVLAMPLAFKNAGLLVGCIGTMLIGLICGHVIHILVKTSQQL 547 N S+ A+ LLK+ +G+GVL +P AFK GL+ +++G++ +L++T ++ Sbjct: 274 NASNGKAVLLLLKSFVGTGVLFLPKAFKLGGLVFSSATLLIVGVLSHICFLLLIQTRMKV 333 >SPBC1685.07c |||amino acid transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 420 Score = 37.1 bits (82), Expect = 0.002 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 326 MGPYVPANHRPMESNTSS---FGALAHLLKASLGSGVLAMPLAFKNAGLLVGCI 478 M Y P + P + + F ++ +L LG+G+L++P AF GLL GC+ Sbjct: 1 MSGYSPLSSGPADVHIGKAGFFSSVINLANTILGAGILSLPNAFTKTGLLFGCL 54 >SPBC17G9.13c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 317 Score = 25.8 bits (54), Expect = 6.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 689 LPYE*QPTTSPLVLWQSM 636 LPY PT+ P+V W S+ Sbjct: 280 LPYNPHPTSKPVVSWDSL 297 >SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1568 Score = 25.8 bits (54), Expect = 6.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 596 IVFQNGPKPIRKFASIARELVDWS 667 I+ Q+G ++KF + RELV++S Sbjct: 740 IMLQSGDMRVKKFLELIRELVEFS 763 >SPCC737.03c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 615 Score = 25.8 bits (54), Expect = 6.1 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 449 KNAGLLVGCIGTMLIGLICGHVIHILVKTSQQLCVEV 559 +NA LL+ L+GLICG ++ LC+ V Sbjct: 561 RNAKLLIAFTILFLVGLICGWRLNRFTMFIYYLCILV 597 >SPBC18E5.13 ||SPBC23G7.03|translation initiation factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 233 Score = 25.8 bits (54), Expect = 6.1 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 233 KTKPSAPPIQLVMDDNYSSKIELAYNGSREDMGPYVPANH 352 + K + P+ + D+ SKI+L G +DM P + +H Sbjct: 178 QNKKRSQPVSQEVRDSILSKIQLEIEGLGKDMKPPIVNSH 217 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 25.4 bits (53), Expect = 8.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 398 LLKASLGSGVLAMPLAFKNAGLLVGCIGTMLIG 496 +LKAS+ S +L + F N+ + C+G ++ G Sbjct: 3560 VLKASVNSALLTSWICFLNSIGAINCVGIVVSG 3592 >SPAC29E6.02 |prp3|SPAC30.06|U4/U6 x U5 tri-snRNP complex subunit Prp3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 542 Score = 25.4 bits (53), Expect = 8.1 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +2 Query: 596 IVFQNGPKPIRKFASIARELVDWS 667 ++F+ G K I+K + E +DW+ Sbjct: 439 VIFEAGQKAIKKLKRLMLERIDWT 462 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,348,195 Number of Sequences: 5004 Number of extensions: 75873 Number of successful extensions: 208 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 208 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -