BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0702 (695 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ... 37 0.41 UniRef50_Q23BZ4 Cluster: Putative uncharacterized protein; n=1; ... 34 2.9 UniRef50_A2VBJ9 Cluster: Non-ribosomal peptide synthetase; n=1; ... 33 6.7 >UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 275 Score = 37.1 bits (82), Expect = 0.41 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 633 RGGARYPIRPIVSRIT 680 RGGARYPIRPIVSRIT Sbjct: 260 RGGARYPIRPIVSRIT 275 >UniRef50_Q23BZ4 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 2189 Score = 34.3 bits (75), Expect = 2.9 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = +3 Query: 393 FHLT**YLFNQNIYHYYLY*AALKVSGMEYFHCSCHIKIFLIENSLVLKIEYHL-FI*KK 569 +H+ YLFNQN Y++ ++ G YF+ + ++ L N+L+LK + F Sbjct: 757 YHMAIPYLFNQNNYNF-------QIEG-GYFNTATYVFKVLFTNTLILKKQNQTSFAPST 808 Query: 570 ILGLVTRFCQTSLV 611 IL VT C T+ + Sbjct: 809 ILATVTNLCPTTAI 822 >UniRef50_A2VBJ9 Cluster: Non-ribosomal peptide synthetase; n=1; uncultured bacterium|Rep: Non-ribosomal peptide synthetase - uncultured bacterium Length = 338 Score = 33.1 bits (72), Expect = 6.7 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 675 YDSL*GELGTGPPLE 631 YDSL GELGTGPPLE Sbjct: 278 YDSLYGELGTGPPLE 292 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,521,777 Number of Sequences: 1657284 Number of extensions: 10337326 Number of successful extensions: 14591 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14584 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54958682807 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -