BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0702 (695 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC417.04 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual 31 0.21 SPAC2H10.01 |||transcription factor, zf-fungal binuclear cluster... 29 0.84 >SPCC417.04 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual Length = 180 Score = 30.7 bits (66), Expect = 0.21 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -2 Query: 190 CISRSFVISMEF*LINCNTY*YEINYLIKKQICCSNTSWTVSELV 56 C + F++ F LI CN+ + YLI + S+T W L+ Sbjct: 109 CCAYQFILRNRFLLIWCNSETIHLTYLIDTVVIESSTFWCTGSLI 153 >SPAC2H10.01 |||transcription factor, zf-fungal binuclear cluster type|Schizosaccharomyces pombe|chr 1|||Manual Length = 480 Score = 28.7 bits (61), Expect = 0.84 Identities = 21/64 (32%), Positives = 28/64 (43%) Frame = -3 Query: 624 PFSQRLKKFDKTS*QDRESFFK*INGIRFLKPRSFQLKIF*YDRNSGNIPFPILLVQPSI 445 P SQ L +F S +E+ + + PRS L F D N+ N P LL + Sbjct: 188 PSSQPLDRFSPASFPSKETLTS--SSLSSSVPRSVSLSNF-ADSNTSNYPESSLLPAAKV 244 Query: 444 DNNG 433 NNG Sbjct: 245 GNNG 248 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,526,328 Number of Sequences: 5004 Number of extensions: 47577 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -