BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0700 (820 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 28 0.30 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 25 3.7 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 8.6 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 28.3 bits (60), Expect = 0.30 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 302 YNGY--PTLQTETHYCFTAEIGRVVVPTGADSQ*SILTSPQRKAPQ 433 Y+ Y P L + HYC + I VV + I T PQR P+ Sbjct: 58 YSSYVLPKLYAKLHYCVSCAIHSKVVRNRSKETRRIRTPPQRSFPK 103 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 24.6 bits (51), Expect = 3.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 404 LTSPQRKAPQIYKNIFSECL 463 LT+ RK I+K +F ECL Sbjct: 447 LTAAIRKHTDIFKKLFQECL 466 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.4 bits (48), Expect = 8.6 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 363 GWWYLQVRTHNKVFLRVRREKPLRFTRTSFQNV 461 G W L TH K R R LR ++FQ V Sbjct: 791 GRWVLDKETHRKSVQRAHRPGALR-VASAFQTV 822 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 784,010 Number of Sequences: 2352 Number of extensions: 15078 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -