BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0698 (629 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6849| Best HMM Match : EGF_2 (HMM E-Value=9.3e-11) 31 0.58 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_26245| Best HMM Match : Homeobox (HMM E-Value=1.7e-32) 29 3.1 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_42963| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_10933| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_34458| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) 28 7.2 SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) 28 7.2 SB_1374| Best HMM Match : PAN (HMM E-Value=0.013) 27 9.5 >SB_6849| Best HMM Match : EGF_2 (HMM E-Value=9.3e-11) Length = 439 Score = 31.5 bits (68), Expect = 0.58 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -2 Query: 511 RCDRHGLHEGCRVGSGSKRATCDVGVGSDVGARS 410 +CD G H C++ +G K TCD G ++VG S Sbjct: 76 KCDGCG-HGSCQISAGKKSCTCDYGWLNNVGDAS 108 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 29.1 bits (62), Expect = 3.1 Identities = 24/80 (30%), Positives = 34/80 (42%) Frame = +2 Query: 293 TPLLASTSYVSSIPLISQPIAYSAHFIKKRSPQWPVSYIAPSSYITPNTYIASGPLGATT 472 TP T S P + + I +P P ++ PS+ TP+T S P +T Sbjct: 26 TPSTPRTPSTPSTPCTPSTPSTPSTPITPSTPSTPCTHSTPSAPSTPST--PSTPCTPST 83 Query: 473 YTTPFVQTVPIASTASLPVA 532 +TP + P ST S P A Sbjct: 84 PSTPSTPSTP--STPSTPSA 101 Score = 28.7 bits (61), Expect = 4.1 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +2 Query: 365 HFIKKRSPQWPVSYIAPSSYITPNT-YIASGPLGATTYTTPFVQTVPIA-STASLP 526 H +K +P P + PS+ TP+T S P T +TP + PI ST S P Sbjct: 5 HRLKLSTPSTPCTPSTPSTPSTPSTPRTPSTPSTPCTPSTPSTPSTPITPSTPSTP 60 >SB_26245| Best HMM Match : Homeobox (HMM E-Value=1.7e-32) Length = 1168 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +3 Query: 384 LHNGP*ATSLLAPTSLPTPTSQVALLEPLPTRHPSCRPCRSHRLHHFPSQ 533 LH+ T+LL P ++ P Q LL+P+ P + S HH+ ++ Sbjct: 668 LHHQNHNTTLLQPVTITPPKPQHTLLQPVTITPPKPQHNTSTTSHHYTTK 717 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 410 APSSYITPNTYIASGPLGATTYTTPFVQTVPIASTASLPV 529 APSS +T +GP TT P V T+ +TA+ P+ Sbjct: 804 APSSNPNESTTPTTGPTTGTTALPPGVTTITTPATATTPL 843 >SB_42963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +3 Query: 390 NGP*ATSLLAPTSLPTPTSQVALLEPLPTRHPSCRPCRS 506 N P + LL LPT Q+ L +P P PS P RS Sbjct: 278 NTPFVSRLLLALVLPTMHLQLLLTKPTPATPPSRAPTRS 316 >SB_10933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 275 TTYHGKTPLLASTSYVSSIP 334 T YHG TP ST Y SIP Sbjct: 387 TPYHGSTPYRGSTPYRGSIP 406 >SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 28.3 bits (60), Expect = 5.4 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +2 Query: 377 KRSPQWPVSYIAPSSYITPNTYIASGPLGATTYTTPFVQTVPIASTASLP 526 K++ PVS ++ TP + P T TP +T P ASTA P Sbjct: 291 KKTTTKPVSQPGETTASTPKAPGPTQPASTTIEATPQPETQPGASTAKAP 340 >SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 27.9 bits (59), Expect = 7.2 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 2/72 (2%) Frame = +2 Query: 329 IPLISQPIAYS--AHFIKKRSPQWPVSYIAPSSYITPNTYIASGPLGATTYTTPFVQTVP 502 +P+I P ++ +HF+ S P+ I SSY + +++SG L Y T + + V Sbjct: 314 LPIIGYPTSHHRVSHFL---SSGIPLPIIGLSSYHRVSHFLSSGCLPIIGYPTSYHRVVF 370 Query: 503 IASTASLPVAAH 538 +S LP+ + Sbjct: 371 PSSGIPLPIIGY 382 >SB_34458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1318 Score = 27.9 bits (59), Expect = 7.2 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +2 Query: 380 RSPQWPVSYIAPSSY--ITPNTYIASGPLGATTYTTPFVQTVPIASTASLPV 529 R P PVSY P+SY P + +S P+ + + +TP + PI ++S+ V Sbjct: 40 RRPPVPVSYELPASYQRSVPVSTSSSTPVSSPSNSTP---STPIRKSSSVTV 88 >SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -2 Query: 130 TDSCRSPEKPQLLGTSREASRRLQAQQPRQLIKHTLST 17 TD PE+P G S ++ RR PR+ + T S+ Sbjct: 374 TDQTPRPERPVPAGASPQSRRRRPVPTPRRTVHKTTSS 411 >SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) Length = 1211 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 384 LHNGP*ATSLLAPTSLPTPTSQVALLEPLPTRHPSCRPC 500 LH+ P + S +P S P + + P P HPS +PC Sbjct: 463 LHSHP-SPSQPSPVSHPPAQALLHTSHPSPATHPSPKPC 500 >SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 27.9 bits (59), Expect = 7.2 Identities = 20/50 (40%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +2 Query: 395 PVSYIAPSSYITPNTYIASGPLGAT-TYTTPFVQTVPIASTASLPVAAHL 541 P + AP + P T AS A T T V T P A+TASL A L Sbjct: 154 PETTTAPEATTAPETTTASLVTTAPETTTASLVTTAPEATTASLATTASL 203 >SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) Length = 3094 Score = 27.9 bits (59), Expect = 7.2 Identities = 20/80 (25%), Positives = 30/80 (37%) Frame = +2 Query: 275 TTYHGKTPLLASTSYVSSIPLISQPIAYSAHFIKKRSPQWPVSYIAPSSYITPNTYIASG 454 TT G+T T+ I + + + + PV+ IAP S + P T +A Sbjct: 1896 TTVAGETTAAPDTTMAPEITVAPETTVAPETTVVPETTSAPVTTIAPESTLVPETTVAPD 1955 Query: 455 PLGATTYTTPFVQTVPIAST 514 A T T+P T Sbjct: 1956 TTVAPETTVVPETTMPPPKT 1975 >SB_1374| Best HMM Match : PAN (HMM E-Value=0.013) Length = 498 Score = 27.5 bits (58), Expect = 9.5 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +3 Query: 150 CIPHPWSTLHRMATLISSRRGLLHMLRISLLHHTLLFLPS*QPPTTVKLLSWL 308 CI W LH LI+S RGL ++ + +H F+P T+ + LS++ Sbjct: 403 CIHMTWVMLH--IGLITSSRGLSYITSTRMCNHMTRFMPHIGLITSSRGLSYI 453 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,327,024 Number of Sequences: 59808 Number of extensions: 368779 Number of successful extensions: 1303 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1297 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -