BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0694 (603 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 34 2.3 UniRef50_Q64N94 Cluster: Putative transcriptional regulator; n=2... 34 3.0 UniRef50_Q7VFV2 Cluster: Putative uncharacterized protein; n=1; ... 32 9.1 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 34.3 bits (75), Expect = 2.3 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 506 AERWYLPVRTHKRSYRQ 456 AE WYLP RTHKRSY + Sbjct: 569 AEWWYLPARTHKRSYHR 585 >UniRef50_Q64N94 Cluster: Putative transcriptional regulator; n=2; Bacteroides fragilis|Rep: Putative transcriptional regulator - Bacteroides fragilis Length = 278 Score = 33.9 bits (74), Expect = 3.0 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +1 Query: 166 KRSHISRRCLSVTTGFPDSDLILRLNFDLLSQ 261 K ++S +CL +T FPD D++ +LN + L+Q Sbjct: 10 KSLYLSTQCLLITISFPDMDIVDKLNREFLTQ 41 >UniRef50_Q7VFV2 Cluster: Putative uncharacterized protein; n=1; Helicobacter hepaticus|Rep: Putative uncharacterized protein - Helicobacter hepaticus Length = 985 Score = 32.3 bits (70), Expect = 9.1 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Frame = +1 Query: 217 DSDLILRLNFDLLSQGQQKTD--SGDKK*PLISLQ*VAQELATDNRNSISTMSELLAYSI 390 DS+L + LN D+ S+ ++ +G+ P +L+ Q+L DN N I + AY Sbjct: 373 DSNLEVNLNIDIQSKDKRIHTFVNGNITTPNTTLEAGGQKLIADNFNLIFVNAPNRAYIQ 432 Query: 391 ISNTQSHYSSNL 426 + NT+ +Y++N+ Sbjct: 433 LLNTKINYANNI 444 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 550,160,328 Number of Sequences: 1657284 Number of extensions: 10367405 Number of successful extensions: 21205 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21204 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 42732687689 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -