BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0694 (603 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 5.3 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 9.3 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 9.3 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 9.3 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 9.3 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 9.3 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 9.3 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 9.3 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 9.3 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 9.3 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 9.3 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 9.3 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 9.3 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 9.3 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 9.3 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 9.3 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -2 Query: 314 CRDIKGYFLSPES 276 CRDI FL PES Sbjct: 642 CRDIPEEFLRPES 654 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 36 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 36 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 36 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 36 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 36 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 36 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 36 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.0 bits (42), Expect = 9.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 269 KKPTPVTKNNL*YLYN 316 KKPTPV K+ L + N Sbjct: 217 KKPTPVQKHALPIIMN 232 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 285 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 285 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 285 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 285 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 285 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 285 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 266 CP*DKRSKFNRKIKSESGNPVVTDKHLREMCER 168 C D+ ++ +K + V +KHLRE R Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKHLRERTSR 285 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,536 Number of Sequences: 438 Number of extensions: 3228 Number of successful extensions: 18 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -