BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0692 (710 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 24 1.4 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 23 1.9 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 23 2.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.9 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 165 TFLRWVNSTSN*LQTLYNYFRL*HYS*IFFTLLRLV 58 T+L + T +Q NY L HY +FFT+ +V Sbjct: 501 TYLMFDYCTVLRVQRFNNYQSLAHYLRVFFTVFNVV 536 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +3 Query: 210 WSKLKFCSCAVSVFYPQFRCICVEGMLDVGTVSNVGKQKHEL 335 W+++ + + A F +C +GTVS G+ H++ Sbjct: 277 WTRIAYMALASVPFIFDSIHLCDVCYSTIGTVSKAGELIHQI 318 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -1 Query: 584 NFLLNIFDFIFGFFQVYYFNGYNLLGSIVH 495 NF +FG Q+Y F+G+ + +V+ Sbjct: 75 NFQFGSILALFGVVQIYIFSGFIVPSGVVY 104 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 23.0 bits (47), Expect = 2.5 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -2 Query: 421 FSL-KAITLAGLLLRPTFSIYLFTMCIKTNSSCFCF 317 FSL KAI + + +R TFS + I S+ F F Sbjct: 83 FSLCKAILVHAITIRSTFSWTFIDVFIMLTSTAFVF 118 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.9 Identities = 6/20 (30%), Positives = 14/20 (70%) Frame = -1 Query: 146 TARLTSYRHFIIIFDFDTTH 87 +++ ++ HF+I+F +T H Sbjct: 158 SSKKPAFSHFLIVFFTETLH 177 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.9 Identities = 6/20 (30%), Positives = 14/20 (70%) Frame = -1 Query: 146 TARLTSYRHFIIIFDFDTTH 87 +++ ++ HF+I+F +T H Sbjct: 158 SSKKPAFSHFLIVFFTETLH 177 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.9 Identities = 6/20 (30%), Positives = 14/20 (70%) Frame = -1 Query: 146 TARLTSYRHFIIIFDFDTTH 87 +++ ++ HF+I+F +T H Sbjct: 158 SSKKPAFSHFLIVFFTETLH 177 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.9 Identities = 6/20 (30%), Positives = 14/20 (70%) Frame = -1 Query: 146 TARLTSYRHFIIIFDFDTTH 87 +++ ++ HF+I+F +T H Sbjct: 158 SSKKPAFSHFLIVFFTETLH 177 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,225 Number of Sequences: 336 Number of extensions: 3266 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -