BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0688 (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24584| Best HMM Match : bZIP_1 (HMM E-Value=0.0086) 35 0.072 SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) 33 0.17 SB_58746| Best HMM Match : RA (HMM E-Value=0.85) 31 0.89 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 31 1.2 SB_33357| Best HMM Match : Neur_chan_memb (HMM E-Value=8.3e-10) 30 2.0 SB_39075| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 29 4.7 SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_1589| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_51795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_10488| Best HMM Match : aPHC (HMM E-Value=0.82) 28 6.2 SB_13194| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_11938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_7400| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_24584| Best HMM Match : bZIP_1 (HMM E-Value=0.0086) Length = 404 Score = 34.7 bits (76), Expect = 0.072 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 6/83 (7%) Frame = -1 Query: 484 ESAHLVFTSLMVVDVFVHGY----MDGIGLRDGHLYFFFDLNGIRLFDFIGHWFFD--RV 323 +S + VF L V + GY + G+ + +G Y F L G+R+ + G+W F+ RV Sbjct: 275 DSGYWVFGLLSVRVIEGSGYWVFGLLGVRVIEGSGYLMFGLLGVRVIEGSGYWVFELLRV 334 Query: 322 RYWFFNNLVDNLINRYMDRLLHC 254 R+++ + I Y + C Sbjct: 335 RHYYATTWSRSAIGDYQPSIKGC 357 >SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 34.7 bits (76), Expect = 0.072 Identities = 20/36 (55%), Positives = 22/36 (61%) Frame = +2 Query: 140 PYHVTVVKKIGVPIPHPVAVSVPQYVKVPIPQPYPV 247 P+H T + VP P PV S PQ KVPIP PYPV Sbjct: 447 PFH-TPPRVEHVPFPIPVH-SPPQIEKVPIPFPYPV 480 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = +2 Query: 173 VPIPHPVAVSVPQYVKVPIPQPYPVHVTVEQP 268 VPIP P V P +K P PYPV V V QP Sbjct: 472 VPIPFPYPVPSPPQIK---PMPYPVPVPVRQP 500 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 33.9 bits (74), Expect = 0.13 Identities = 31/105 (29%), Positives = 48/105 (45%) Frame = +3 Query: 105 SPKATRTQNTRSRTM*PW*RRSEFRFPIRWLCRSRST*RCPYLNPTRSTSQWSNLSMYLF 284 S ++ + +RSR+ P R+ + P R RS R +P R TS+WS+ S Sbjct: 622 SSRSRSSSYSRSRSRSPDRRKRSYSPPPR----RRSPFRERRRSPPRRTSRWSSQSPDRR 677 Query: 285 IRLSTKLLKNQYRTRSKNQCPMKSKSLIPLRSKKK*RCPSLSPIP 419 K + R+RS++ P SKS P SK + + +P P Sbjct: 678 SPARIKSSPARSRSRSQSASPRHSKSKSPALSKVQVKTEKKTPSP 722 >SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) Length = 2157 Score = 33.5 bits (73), Expect = 0.17 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 167 IGVPIPHPVAVSVPQYVKVPIPQPYPV 247 + VP+P PV V VP + + P+P P P+ Sbjct: 1092 VPVPVPVPVRVPVPMHQQSPLPMPRPI 1118 >SB_58746| Best HMM Match : RA (HMM E-Value=0.85) Length = 820 Score = 31.1 bits (67), Expect = 0.89 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FDL G +FD G+ FD Y F+ Sbjct: 341 VFDMFGYSVFDMFGYSVFDMFCYSVFDLFGYSVFDMFGYSVFDMFGYSVFD 391 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FDL G +FD G+ FD Y F+ Sbjct: 309 VFDMFGYSVFDLFGYSVFDMFGYSVFDLFGYSVFDMFGYSVFDMFGYSVFD 359 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FDL G +FD G+ FD Y F+ Sbjct: 389 VFDMFGYSVFDMFGYSVFDMFGYSVFDLFGYSVFDMFGYSVFDMFGYSVFD 439 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FDL G +FD G+ FD Y F+ Sbjct: 293 VFDMFGYSVFDMFGYSVFDMFGYSVFDLFGYSVFDMFGYSVFDLFGYSVFD 343 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 365 VFDLFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 415 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 413 VFDLFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 463 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 421 VFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 471 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 429 VFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 479 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 437 VFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 487 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 445 VFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 495 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 453 VFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 503 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 461 VFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 511 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 469 VFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 519 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 477 VFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 527 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 485 VFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 535 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 269 VFDMFGYSVFDMFGYSVFDLFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 319 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 277 VFDMFGYSVFDLFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDLFGYSVFD 327 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 373 VFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFDLFGYSVFD 423 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 397 VFDMFGYSVFDMFGYSVFDLFGYSVFDMFGYSVFDMFGYSVFDMFGYSVFD 447 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -1 Query: 451 VVDVFVHGYMD--GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVRYWFFN 305 V D+F + D G + D Y FD+ G +FD G+ FD Y F+ Sbjct: 317 VFDLFGYSVFDMFGYSVFDLFGYSVFDMFGYSVFDMFGYSVFDMFCYSVFD 367 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/45 (42%), Positives = 24/45 (53%) Frame = +2 Query: 122 HTEHTKPYHVTVVKKIGVPIPHPVAVSVPQYVKVPIPQPYPVHVT 256 H H P+ V V + VP PV V VP V+VP+P PV+ T Sbjct: 208 HHHHHHPFPVRV--PVRVPFRVPVRVPVP--VRVPVPIHSPVYPT 248 Score = 28.3 bits (60), Expect = 6.2 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 116 HTHTEHTKPYHVTVVKKIGVPIPHPVAVSVPQYVKVPIPQP-YP 244 H H H P V V VP+ PV V VP VPI P YP Sbjct: 208 HHHHHHPFPVRVPVRVPFRVPVRVPVPVRVP----VPIHSPVYP 247 >SB_33357| Best HMM Match : Neur_chan_memb (HMM E-Value=8.3e-10) Length = 306 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 107 PEGHTHTEHTKPYHVTVVKKIGVPIPHPVAVSVPQYVKVPIPQPYP 244 P+G + EHT ++ ++ I I +PV + V VP +P P Sbjct: 145 PKGSQNNEHTSNNYINILVTIRTEIVYPVRPVIGAAVAVPDRRPCP 190 >SB_39075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/74 (22%), Positives = 32/74 (43%) Frame = -1 Query: 355 DFIGHWFFDRVRYWFFNNLVDNLINRYMDRLLHCDVDRVGLRYGHLHVLRDRHSHRMGNR 176 D +W D R ++ ++RY + D R +R H +RD+H +R+ + Sbjct: 16 DMHRYWLGDMQRMSKISDKQRYDVHRYWLGDMQRDKHRNRIRDNKRHAIRDKHRNRIRDN 75 Query: 175 NSDLLHHGHMVRLR 134 + H+ R+R Sbjct: 76 KRHAIRDKHIQRIR 89 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 134 TKPYHVTVVKKIGV--PIPHPVAVSVPQYVKVPIPQPYPVHVTVEQP 268 +KP +K V P P +S P + +P+P P PV V QP Sbjct: 96 SKPMREDAKRKFLVLAPFPRMPLISPPLPMYIPVPVPQPVPQPVPQP 142 >SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1446 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +2 Query: 131 HTKPYHVTVVKKIGVPIPHPVAVSVPQYVKVPIPQPYPVHVTVEQ 265 HT P H+ +I P+PH + IP P P H T Q Sbjct: 976 HTSPAHLATASQITHPLPHRT---------ISIPYPSPPHTTSSQ 1011 >SB_1589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 418 GIGLRDGHLYFFFDLNGIRLFDFIGHWFFDRVR 320 GI D + D +R+F+F G+W F+ +R Sbjct: 10 GIKPNDSWICLRDDFGDVRVFEFSGYWMFELLR 42 >SB_51795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 28.3 bits (60), Expect = 6.2 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = -1 Query: 373 NGIRLFDFIGHWFFDRVR 320 +G R+F+F+G+W F+ +R Sbjct: 30 SGYRMFEFLGYWMFELLR 47 >SB_10488| Best HMM Match : aPHC (HMM E-Value=0.82) Length = 208 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 5/54 (9%) Frame = -1 Query: 370 GIRLFDFIGHWFFDRVRYWFFNNLVDNLINRYMDRL-----LHCDVDRVGLRYG 224 G+ L I W F R R+W+ + L Y+ L LH DVD L +G Sbjct: 50 GLLLLTIITQWIFKRYRFWYVH--YTGLALAYVTILAIFHDLHVDVDLYALVFG 101 >SB_13194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 122 HTEHTKPYHVTVVKKIGVPIPHPVAVSVPQYVKVPIP 232 + + T PY V + V +P+ V V+VP YV V +P Sbjct: 58 YVDGTVPYVDVTVPYVDVTVPYNVDVTVP-YVDVTVP 93 >SB_11938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 122 HTEHTKPYHVTVVKKIGVPIPHPVAVSVPQYVKVPIP 232 + + T PY V + V +P+ V V+VP YV V +P Sbjct: 58 YVDGTVPYVDVTVPYVDVTVPYNVDVTVP-YVDVTVP 93 >SB_7400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1499 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 167 IGVPIPHPVAVSVPQYVKVPIPQPYPVHVTV 259 + P P V V+ P V+VP P PV V V Sbjct: 839 VATPPPVRVTVATPPPVRVPAATPLPVRVPV 869 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,878,783 Number of Sequences: 59808 Number of extensions: 468665 Number of successful extensions: 1604 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1577 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -