BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0686 (540 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.5 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 6.1 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 6.1 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 1.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 99 AVVVDSVLRRVLYEHGGGRVRLSSPYEYR 13 A +V+S LR ++ GRV +P+E+R Sbjct: 961 AFIVNSNLRLTFSKNVQGRVGFVTPFEHR 989 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 6.1 Identities = 15/59 (25%), Positives = 23/59 (38%) Frame = +1 Query: 142 ASADGISKAPRPLSNILPSGGIRPNSNVSTQTXXXXXXXXXKQRGKPGVRSPAPANKQD 318 A++ + P +N PS R S S+ T G+P R+ NKQ+ Sbjct: 494 AASTAVIHEPVVETNSSPSPNPRIASAPSSSTSSSPPAKGAAAAGQPSKRNGGETNKQE 552 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 6.1 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = +1 Query: 85 VHHNSVSVACATPTTAKPRASADGISKAPRPLSNILPSGGIRPNSNVS 228 +HH V+ A+P K S+ G S LS L S PN VS Sbjct: 341 MHHLHVAKQMASPEPPKSSESSTGSSIPKLNLSTALMSQP-PPNFGVS 387 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.308 0.124 0.354 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,947 Number of Sequences: 438 Number of extensions: 2589 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.2 bits)
- SilkBase 1999-2023 -