BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0685 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 21 7.3 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.7 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 21.4 bits (43), Expect = 7.3 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = -1 Query: 386 VVSAVGSDAAFCSSDWPHPV 327 +V+ +G DA +C + +P+ Sbjct: 289 IVAPLGYDAYYCGGECEYPI 308 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 9.7 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -1 Query: 467 GGSCSEPVCLARSLSAPSDRTSSSLTIVVSAVGSDAAFCSSD 342 G ++PV AR AP + T+ SAVG + +D Sbjct: 515 GRLVAKPVADARDAPAPFLLKRENYTLPASAVGIAWLYVDND 556 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,885 Number of Sequences: 336 Number of extensions: 2633 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -