BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0680 (730 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 36 0.036 At1g23540.1 68414.m02960 protein kinase family protein contains ... 35 0.048 At4g00890.1 68417.m00120 proline-rich family protein contains pr... 34 0.11 At3g03300.1 68416.m00327 DEAD/DEAH box helicase carpel factory-r... 33 0.19 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 33 0.26 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 33 0.26 At4g16280.1 68417.m02469 flowering time control protein / FCA ga... 33 0.26 At3g24540.1 68416.m03082 protein kinase family protein contains ... 32 0.34 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 31 0.78 At4g32010.1 68417.m04557 transcriptional factor B3 family protei... 31 0.78 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 31 0.78 At1g20750.1 68414.m02599 helicase-related similar to BRCA1-bindi... 31 0.78 At3g60920.1 68416.m06815 beige/BEACH domain-containing protein c... 30 1.4 At1g26150.1 68414.m03192 protein kinase family protein similar t... 30 1.4 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 30 1.8 At2g46420.1 68415.m05777 expressed protein 30 1.8 At1g61080.1 68414.m06877 proline-rich family protein 30 1.8 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 29 2.4 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 29 2.4 At3g28110.1 68416.m03508 hypothetical protein 29 2.4 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 29 2.4 At2g22680.1 68415.m02688 zinc finger (C3HC4-type RING finger) fa... 29 2.4 At4g34440.1 68417.m04894 protein kinase family protein contains ... 29 3.2 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 29 3.2 At2g39530.1 68415.m04850 integral membrane protein, putative con... 29 4.2 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 29 4.2 At1g67290.1 68414.m07658 glyoxal oxidase-related contains simila... 29 4.2 At3g13300.2 68416.m01675 transducin family protein / WD-40 repea... 28 5.5 At3g13300.1 68416.m01674 transducin family protein / WD-40 repea... 28 5.5 At2g47030.1 68415.m05876 pectinesterase family protein contains ... 28 5.5 At1g64830.1 68414.m07350 aspartyl protease family protein contai... 28 5.5 At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-relate... 28 5.5 At1g02640.1 68414.m00214 glycosyl hydrolase family 3 protein sim... 28 5.5 At5g55020.1 68418.m06853 myb family transcription factor (MYB120... 28 7.3 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 28 7.3 At1g16710.1 68414.m02003 TAZ zinc finger family protein / zinc f... 28 7.3 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 28 7.3 At5g66050.1 68418.m08319 expressed protein 27 9.6 At5g45275.1 68418.m05557 expressed protein Requires functional a... 27 9.6 At4g30260.1 68417.m04302 integral membrane Yip1 family protein c... 27 9.6 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 27 9.6 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 27 9.6 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 27 9.6 At2g33290.1 68415.m04080 SET domain-containing protein (SUVH2) i... 27 9.6 At1g70320.1 68414.m08090 ubiquitin-protein ligase 2 (UPL2) nearl... 27 9.6 At1g13470.1 68414.m01578 expressed protein 27 9.6 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 35.5 bits (78), Expect = 0.036 Identities = 27/93 (29%), Positives = 37/93 (39%) Frame = +3 Query: 174 TPVPQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKLNIM 353 TP P VTP S PP + + +P S P++ P P++ PTS Sbjct: 72 TPPPAVTPTS--PPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSP---- 125 Query: 354 IKTSPKSPPRTEAEPHRRFEFPPADPCNAEPAK 452 +P SPP A P PP P + P + Sbjct: 126 -PPTPASPPPAPASPPPAPASPPPAPVSPPPVQ 157 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 35.1 bits (77), Expect = 0.048 Identities = 35/124 (28%), Positives = 48/124 (38%), Gaps = 10/124 (8%) Frame = +3 Query: 114 MDNLSSGGSTNELVIDTARATPVPQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMP 293 M +L S++ A P + SA PPVD S ++S + P T P Sbjct: 1 MSDLGESPSSSPPAPPADTAPPPETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPP 60 Query: 294 --SLEPV-----PLTVDTRPTSKLNIMIKTSPKSPPRTEAE---PHRRFEFPPADPCNAE 443 L P+ PLT P S + + ++P PP T E P E PPA P + Sbjct: 61 DSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESN 120 Query: 444 PAKP 455 P Sbjct: 121 DNNP 124 >At4g00890.1 68417.m00120 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 431 Score = 33.9 bits (74), Expect = 0.11 Identities = 26/91 (28%), Positives = 38/91 (41%) Frame = +3 Query: 159 DTARATPVPQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTS 338 +T T +P PQ A+ P S ++ N+ E+FE P L P +TR S Sbjct: 165 ETGDETQLPIPPPQEAKTPP--SSPSMMLNATEEFE----SQPKPPLLPSKSIDETRLRS 218 Query: 339 KLNIMIKTSPKSPPRTEAEPHRRFEFPPADP 431 L + P P ++ E R + PP P Sbjct: 219 PLMSQASSPPPLPSKSIDENETRSQSPPISP 249 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 345 NIMIKTSPKSPPRTEAEPHRRFEFPPADPCNAEPAKP 455 N++I++ PKSPP + + P P EP P Sbjct: 91 NLLIQSPPKSPPESTESQQQFLASVPLRPLTTEPKTP 127 >At3g03300.1 68416.m00327 DEAD/DEAH box helicase carpel factory-related similar to RNA helicase GB:AAF03534 Length = 1317 Score = 33.1 bits (72), Expect = 0.19 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = -2 Query: 666 YAYAFLFYSRIGLVYRIPCVYLCLSQQDCVKVHS*RTDGKIWTDYFVDF 520 YAY F S V+ +P V L Q + +K+H+ G W D VDF Sbjct: 59 YAYLFRKPSPCFCVFLVPQVVLVTQQAEALKMHTDLKVGMYWGDMGVDF 107 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 32.7 bits (71), Expect = 0.26 Identities = 20/88 (22%), Positives = 40/88 (45%), Gaps = 6/88 (6%) Frame = +3 Query: 183 PQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKLNIMIKT 362 PQ P RP + G + + + P + +P + + T P + LNI ++ Sbjct: 421 PQGLPLPLRPQTNFPGAQAPLQNPYAYSSQLPTSQLPPQQNISRA--TAPQTPLNINLRP 478 Query: 363 SPKS------PPRTEAEPHRRFEFPPAD 428 + S PPR++ +P ++ + PP++ Sbjct: 479 TTVSSATVQFPPRSQQQPLQKMQHPPSE 506 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 32.7 bits (71), Expect = 0.26 Identities = 20/88 (22%), Positives = 40/88 (45%), Gaps = 6/88 (6%) Frame = +3 Query: 183 PQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKLNIMIKT 362 PQ P RP + G + + + P + +P + + T P + LNI ++ Sbjct: 421 PQGLPLPLRPQTNFPGAQAPLQNPYAYSSQLPTSQLPPQQNISRA--TAPQTPLNINLRP 478 Query: 363 SPKS------PPRTEAEPHRRFEFPPAD 428 + S PPR++ +P ++ + PP++ Sbjct: 479 TTVSSATVQFPPRSQQQPLQKMQHPPSE 506 >At4g16280.1 68417.m02469 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 505 Score = 32.7 bits (71), Expect = 0.26 Identities = 20/88 (22%), Positives = 40/88 (45%), Gaps = 6/88 (6%) Frame = +3 Query: 183 PQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKLNIMIKT 362 PQ P RP + G + + + P + +P + + T P + LNI ++ Sbjct: 179 PQGLPLPLRPQTNFPGAQAPLQNPYAYSSQLPTSQLPPQQNISRA--TAPQTPLNINLRP 236 Query: 363 SPKS------PPRTEAEPHRRFEFPPAD 428 + S PPR++ +P ++ + PP++ Sbjct: 237 TTVSSATVQFPPRSQQQPLQKMQHPPSE 264 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 32.3 bits (70), Expect = 0.34 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 5/56 (8%) Frame = +3 Query: 303 PVPLTVDTRPTSKLNIMIKTSPKSPPR---TEAEPH--RRFEFPPADPCNAEPAKP 455 P PL + P K + + SP PPR T P R PPA P EP P Sbjct: 50 PEPLFSEPPPPPKAPVNVSLSPPPPPRSPSTSTPPRLGNRNPPPPASPSGQEPTTP 105 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 31.1 bits (67), Expect = 0.78 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 5/98 (5%) Frame = +3 Query: 177 PVPQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEP---VPLTVDTRPTSKLN 347 P VTP +PPV ++L ++ TP PS++P P T +P + Sbjct: 81 PTIPVTP--VKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSP 138 Query: 348 IMIKTSP--KSPPRTEAEPHRRFEFPPADPCNAEPAKP 455 + T+P +SPP + ++ P P P KP Sbjct: 139 VKPPTTPPVQSPP-VQPPTYKPPTSPVKPPTTTPPVKP 175 Score = 28.3 bits (60), Expect = 5.5 Identities = 25/93 (26%), Positives = 34/93 (36%), Gaps = 4/93 (4%) Frame = +3 Query: 180 VPQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPV--PLT--VDTRPTSKLN 347 +P V P + +PP ++ S ++ TP P+ PV P T V + P Sbjct: 99 LPPVQPPTYKPPTPT--VKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPT 156 Query: 348 IMIKTSPKSPPRTEAEPHRRFEFPPADPCNAEP 446 TSP PP T PP P P Sbjct: 157 YKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNP 189 >At4g32010.1 68417.m04557 transcriptional factor B3 family protein low similarity to FUSCA3 [Arabidopsis thaliana] GI:3582518, VIVIPAROUS1 protein [Triticum aestivum] GI:7801376; contains Pfam profile PF02362: B3 DNA binding domain Length = 780 Score = 31.1 bits (67), Expect = 0.78 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +3 Query: 507 EEVEESPQNNLSISSRPFVKNEPLHSPAVRDRDR 608 E E S Q NLSIS P + P H AV DR + Sbjct: 168 ERKELSAQPNLSISLGPTLMTSPFHDAAVDDRSK 201 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 31.1 bits (67), Expect = 0.78 Identities = 22/79 (27%), Positives = 30/79 (37%) Frame = +3 Query: 162 TARATPVPQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSK 341 T R P P P S P + S+ + R TP + P P+SK Sbjct: 435 TVRVLPPPP--PSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSK 492 Query: 342 LNIMIKTSPKSPPRTEAEP 398 ++ +K P PP E EP Sbjct: 493 MSPSVKAYPPPPPPPEYEP 511 Score = 30.7 bits (66), Expect = 1.0 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = +3 Query: 267 RTTPGTSMPSLEPVPLTVDTRPTSKLNIMIKTSPKSPPRTEAEPHRRFEFPPADPCNAEP 446 R TP + P P+SK++ + +P PP ++ P + PP P EP Sbjct: 453 RATPPPPSSKMSPSFRATPPPPSSKMSPSFRATP-PPPSSKMSPSVKAYPPPPPPPEYEP 511 Query: 447 AKP 455 + P Sbjct: 512 SPP 514 >At1g20750.1 68414.m02599 helicase-related similar to BRCA1-binding helicase-like protein BACH1 (GI:13661819) Homo sapiens].; Length = 1179 Score = 31.1 bits (67), Expect = 0.78 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = -1 Query: 334 VGLVSTVNGTGSKEGMLVPGVVLSNCSMLFERSSNPLRSTGGLALW 197 + L+ +GTGS E V++++CS++ +R S+ G +W Sbjct: 1020 LSLLKETSGTGSAEMPTSVSVIMTDCSLVNQRLCTNSESSNGQGIW 1065 >At3g60920.1 68416.m06815 beige/BEACH domain-containing protein contains Pfam PF02138: Beige/BEACH domain; similar to LBA isoform gamma (GI:10257405) [Mus musculus]; similar to beige-like protein (CDC4L) - Homo sapiens; similar to Neurobeachin: kinase A-anchoring, beige/Chediak-higashi protein homolog implicated in neuronal membrane traffic (AKAP550) (GI:11863541) [Drosophila melanogaster]. Length = 1928 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +3 Query: 246 NSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKLNIMIKTSPKSPPRTEAE 395 N++++ T P T M S P T +T P S +NI+ S + + + E Sbjct: 1810 NNVKELNTTDPNTHMVSSFSNPTTSETEPDSDMNIVSTPSNATTNQIDTE 1859 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 30.3 bits (65), Expect = 1.4 Identities = 23/91 (25%), Positives = 36/91 (39%) Frame = +3 Query: 174 TPVPQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKLNIM 353 TP+ P+ + P L+G + + +P +P+ P P + P Sbjct: 66 TPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPP----- 120 Query: 354 IKTSPKSPPRTEAEPHRRFEFPPADPCNAEP 446 ++SP PP TEA P P+ P N P Sbjct: 121 -ESSPPPPPPTEAPPTTPIT-SPSPPTNPPP 149 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 29.9 bits (64), Expect = 1.8 Identities = 24/97 (24%), Positives = 37/97 (38%), Gaps = 2/97 (2%) Frame = +3 Query: 171 ATPVPQVTPQSARPPV--DLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKL 344 + P P + PQS PP + G + S Q R + P PV +P+ + Sbjct: 22 SAPPPGIPPQSGGPPTGSEAVGFRPFTPSASQPTRPFTASGPPPAPPVGTMRPGQPSPFV 81 Query: 345 NIMIKTSPKSPPRTEAEPHRRFEFPPADPCNAEPAKP 455 + I S PP + + P + P P P+ P Sbjct: 82 S-QIPGSRPPPPSSNSFPSPAYGPPGGAPFQRFPSPP 117 >At2g46420.1 68415.m05777 expressed protein Length = 363 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 138 STNELVIDTARATPVPQVTPQSARPPVDLSGLELLSN 248 S N++VIDT A P P + P S + +S + S+ Sbjct: 204 SGNDMVIDTTMAEPTPMIPPNSGMSDMPVSPASVASS 240 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 29.9 bits (64), Expect = 1.8 Identities = 34/143 (23%), Positives = 55/143 (38%), Gaps = 9/143 (6%) Frame = +3 Query: 30 ESSSEGLTNSVMVGAVEKAIDAIERDDT-MDNLSSGGSTNELVIDTARATPVPQVTPQSA 206 ES+ E + + +V +++ D IE D M+ S E V+ + +++ + Sbjct: 339 ESNDEDVIS--VVEEIKQKKDEIESIDVKMETEESVNLDEESVVLNGEQDTIMKISSLES 396 Query: 207 RPPVDLSGLELLSNSIEQFERTTPGTSMPSLE-------PVPLTVDTRPTSKLNIMIKTS 365 L+ E NS + F P P L P+P T P + + I + Sbjct: 397 TSESKLNHSEKYENSSQLFPPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPP 456 Query: 366 PKSPPRTEA-EPHRRFEFPPADP 431 P PP A P + F PP P Sbjct: 457 PPPPPPPPAVMPLKHFAPPPPPP 479 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 29.5 bits (63), Expect = 2.4 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 3/77 (3%) Frame = +3 Query: 231 LELLSNSIEQFER---TTPGTSMPSLEPVPLTVDTRPTSKLNIMIKTSPKSPPRTEAEPH 401 LELLS+ ++ R T PG+S PS P +RP + + P+ P R ++ P Sbjct: 124 LELLSSMLDIPRRNLATKPGSS-PSPSP------SRPPKRS----RGPPRPPTRPKSPPP 172 Query: 402 RRFEFPPADPCNAEPAK 452 R+ FPP+ PAK Sbjct: 173 RKSSFPPSRSPPPPPAK 189 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 29.5 bits (63), Expect = 2.4 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 3/77 (3%) Frame = +3 Query: 231 LELLSNSIEQFER---TTPGTSMPSLEPVPLTVDTRPTSKLNIMIKTSPKSPPRTEAEPH 401 LELLS+ ++ R T PG+S PS P +RP + + P+ P R ++ P Sbjct: 124 LELLSSMLDIPRRNLATKPGSS-PSPSP------SRPPKRS----RGPPRPPTRPKSPPP 172 Query: 402 RRFEFPPADPCNAEPAK 452 R+ FPP+ PAK Sbjct: 173 RKSSFPPSRSPPPPPAK 189 >At3g28110.1 68416.m03508 hypothetical protein Length = 354 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 270 TTPGTSMPSLEPVPLTVDTRPTS 338 T+ GT +P +EP + VDT PTS Sbjct: 235 TSTGTHVPHVEPTGVLVDTTPTS 257 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 29.5 bits (63), Expect = 2.4 Identities = 29/96 (30%), Positives = 37/96 (38%), Gaps = 2/96 (2%) Frame = +3 Query: 174 TP-VPQVTPQ-SARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKLN 347 TP VP TP S PP + + + TP S+PS P P PT + Sbjct: 87 TPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP-PPPTPTPSVPS--PTPPVSPPPPTPTPS 143 Query: 348 IMIKTSPKSPPRTEAEPHRRFEFPPADPCNAEPAKP 455 + T P SPP P PP P + P+ P Sbjct: 144 VPSPTPPVSPPPPTPTPSVPSPTPPV-PTDPMPSPP 178 >At2g22680.1 68415.m02688 zinc finger (C3HC4-type RING finger) family protein contains Pfam profiles PF00097: Zinc finger, C3HC4 type (RING finger), PF00092: von Willebrand factor type A domain Length = 683 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = -1 Query: 247 FERSSNPLRSTGGLALWGVTCGTGVALAVSITSSLVEPP 131 F S P RS G + + C T A AVS TSSL P Sbjct: 41 FSTPSTP-RSDSGTGTYSLRCRTSTATAVSTTSSLPGTP 78 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 29.1 bits (62), Expect = 3.2 Identities = 28/100 (28%), Positives = 39/100 (39%), Gaps = 1/100 (1%) Frame = +3 Query: 159 DTARATPVPQVTPQS-ARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPT 335 +++ TP P S + PP D+S + T+P TS PS P P+ + P Sbjct: 29 ESSPPTPPSSPPPSSISAPPPDISA-SFSPPPAPPTQETSPPTS-PSSSP-PVVANPSPQ 85 Query: 336 SKLNIMIKTSPKSPPRTEAEPHRRFEFPPADPCNAEPAKP 455 + N SPP E PP P N P +P Sbjct: 86 TPEN-------PSPPAPEGSTPVTPPAPPQTPSNQSPERP 118 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 29.1 bits (62), Expect = 3.2 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 7/103 (6%) Frame = +3 Query: 111 TMDNLSSGGSTNELVIDTARATPVPQVTPQS---ARPPVDLSGLELLSNSIEQFERTTPG 281 +M +SSGG ++ + +P+P +TP PP+ ++ + + P Sbjct: 37 SMPPMSSGGGSS---VPPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPM 93 Query: 282 TSM-PSLEPVPLTVDTRPTSKLNIMIKTSPK---SPPRTEAEP 398 M PS P PLTV P+ + +++SP PP A P Sbjct: 94 MPMTPSTSPSPLTVPDMPSPPMPSGMESSPSPGPMPPAMAASP 136 >At2g39530.1 68415.m04850 integral membrane protein, putative contains 3 transmembrane domains; contains Pfam PF04535 : Domain of unknown function (DUF588); similar to putative ethylene responsive element binding protein (GI:22135858) [Arabidopsis thaliana] Length = 178 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -2 Query: 672 DLYAYAFLFYSR-IGLVYRIPCVYLCLSQQDCVKVHS*RTDGKIWTDYFVDFL 517 D+YAY ++ + IGLVY + ++L +SQ K H + D + +L Sbjct: 55 DVYAYRYMLSAAVIGLVYAVVQLFLTISQFATGKTHPLTYQFDFYGDKVISYL 107 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 28.7 bits (61), Expect = 4.2 Identities = 28/97 (28%), Positives = 38/97 (39%), Gaps = 4/97 (4%) Frame = +3 Query: 177 PVPQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKLNIMI 356 P P +P PPV + S I+ P T + S P V T PT + + Sbjct: 226 PTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPV 285 Query: 357 KTSP--KSPPRTEAEPHRR--FEFPPADPCNAEPAKP 455 K P K P T + P + + PP P + P KP Sbjct: 286 KPPPVHKPPTPTYSPPVKSPPVQKPPT-PTYSPPIKP 321 Score = 28.3 bits (60), Expect = 5.5 Identities = 25/97 (25%), Positives = 36/97 (37%), Gaps = 4/97 (4%) Frame = +3 Query: 177 PVPQVTPQSARPPVDLSGLELLSNSIEQ--FERTTPGTSMPSLEPVPLTVDTRPTSKLNI 350 P P +P PPV + S ++ ++ T P ++P PL PT + Sbjct: 361 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPL--QKPPTPTYSP 418 Query: 351 MIKTSPKSPPRTEAEPHRRFE--FPPADPCNAEPAKP 455 IK P PP P + P P + P KP Sbjct: 419 PIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKP 455 Score = 28.3 bits (60), Expect = 5.5 Identities = 21/74 (28%), Positives = 25/74 (33%) Frame = +3 Query: 177 PVPQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKLNIMI 356 P P +P PPV L S ++ P T S P V PT + I Sbjct: 664 PTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPI 723 Query: 357 KTSPKSPPRTEAEP 398 K P P T P Sbjct: 724 KPPPVQVPPTPTTP 737 Score = 27.9 bits (59), Expect = 7.3 Identities = 24/95 (25%), Positives = 34/95 (35%), Gaps = 2/95 (2%) Frame = +3 Query: 177 PVPQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKLNIMI 356 P P +P PPV + S ++ P T + S P + PT + I Sbjct: 344 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPI 403 Query: 357 KTSPKSPPRTE--AEPHRRFEFPPADPCNAEPAKP 455 K P P T + P + P P + P KP Sbjct: 404 KPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKP 438 >At1g67290.1 68414.m07658 glyoxal oxidase-related contains similarity to glyoxal oxidase precursor [Phanerochaete chrysosporium] gi|1050302|gb|AAA87594 Length = 615 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 60 VMVGAVEKAIDAIERDDTMDNLSSGGST 143 V+V AV KA+ ++ DD DN S G T Sbjct: 15 VLVAAVSKAVAEVDNDDDDDNTSLEGMT 42 >At3g13300.2 68416.m01675 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1309 Score = 28.3 bits (60), Expect = 5.5 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 2/81 (2%) Frame = +3 Query: 210 PPVDLSGLELLSNSIEQFERTTPGTSMPS-LEPVPL-TVDTRPTSKLNIMIKTSPKSPPR 383 PP++ GLE +S+ + G S PS L+P L +VD+ P + + S Sbjct: 524 PPIENMGLEKSDSSVSREANLVEGMSEPSGLKPTDLPSVDSVPKPSIIVNRSESANKLSF 583 Query: 384 TEAEPHRRFEFPPADPCNAEP 446 AE + PP N EP Sbjct: 584 PSAEATSQAIVPP----NGEP 600 >At3g13300.1 68416.m01674 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1344 Score = 28.3 bits (60), Expect = 5.5 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 2/81 (2%) Frame = +3 Query: 210 PPVDLSGLELLSNSIEQFERTTPGTSMPS-LEPVPL-TVDTRPTSKLNIMIKTSPKSPPR 383 PP++ GLE +S+ + G S PS L+P L +VD+ P + + S Sbjct: 559 PPIENMGLEKSDSSVSREANLVEGMSEPSGLKPTDLPSVDSVPKPSIIVNRSESANKLSF 618 Query: 384 TEAEPHRRFEFPPADPCNAEP 446 AE + PP N EP Sbjct: 619 PSAEATSQAIVPP----NGEP 635 >At2g47030.1 68415.m05876 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 588 Score = 28.3 bits (60), Expect = 5.5 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -1 Query: 358 LIMMLSFDVGLVSTVNGTGSKEGM-LVPGVVLSNCSMLFERSSNPLRST 215 LI++ G +TV G++ G+ + G+VL NC ++ +R P R T Sbjct: 441 LIVVRKGSKGQYNTVTADGNELGLGMKIGIVLQNCRIVPDRKLTPERLT 489 >At1g64830.1 68414.m07350 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 431 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -1 Query: 448 AGSALQGSAGGNSNLLCGSASVLGGDFGEVLIMMLSFDVGLVSTVN 311 AGS + G GG+++L+ + G F L+ S + GL S +N Sbjct: 212 AGSGIIGLGGGSTSLVSQLRKSINGKFSYCLVPFTS-ETGLTSKIN 256 >At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-related similar to glucan endo-1,3-beta-glucosidase precursor SP:P52409 from [Triticum aestivum] Length = 330 Score = 28.3 bits (60), Expect = 5.5 Identities = 26/107 (24%), Positives = 40/107 (37%), Gaps = 1/107 (0%) Frame = +3 Query: 129 SGGSTNELVIDTARATPV-PQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEP 305 S +T+ V++ P P TP + PPV ++ T P T++P + P Sbjct: 22 SSTTTHHDVLNPPTVFPTNPTTTPTATFPPVTITP-------------TNPATTVPIVPP 68 Query: 306 VPLTVDTRPTSKLNIMIKTSPKSPPRTEAEPHRRFEFPPADPCNAEP 446 V T I I +PP T + ++PP P P Sbjct: 69 VTTIPPPTLTPPPVITIPPPTLTPPVTNPVTNPVTQYPPTQPSGTVP 115 >At1g02640.1 68414.m00214 glycosyl hydrolase family 3 protein similar to beta-xylosidase GB:Z84377 GI:2102655 from [Aspergillus niger] Length = 768 Score = 28.3 bits (60), Expect = 5.5 Identities = 21/73 (28%), Positives = 39/73 (53%) Frame = +3 Query: 18 DSAEESSSEGLTNSVMVGAVEKAIDAIERDDTMDNLSSGGSTNELVIDTARATPVPQVTP 197 D+A E++ G +V+V ++++I+A +D ++L G ELV A+A P + Sbjct: 471 DAAVEAA-RGADATVLVMGLDQSIEAEFKD--RNSLLLPGKQQELVSRVAKAAKGPVILV 527 Query: 198 QSARPPVDLSGLE 236 + P+D+S E Sbjct: 528 LMSGGPIDISFAE 540 >At5g55020.1 68418.m06853 myb family transcription factor (MYB120) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 523 Score = 27.9 bits (59), Expect = 7.3 Identities = 25/101 (24%), Positives = 41/101 (40%), Gaps = 4/101 (3%) Frame = +3 Query: 159 DTARATPVPQVTPQSARPPVDLSGLELLSNSIEQFERTTPGT-SMPSLEPVPLTVDTRPT 335 +T ++P+P TP +A+ + +N + TP T S S P P + + Sbjct: 185 NTPSSSPLPSPTPANAKSSSSFTFHTTTANLLHPLSPHTPNTPSQLSSTPPPPPLSSPLC 244 Query: 336 SKLNIMIKTSPK-SPPRTEAEPHR--RFEFPPADPCNAEPA 449 S N T P + PR++ + F FP P P+ Sbjct: 245 SPRNNQYPTLPLFALPRSQINNNNNGNFTFPRPPPLLQPPS 285 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 27.9 bits (59), Expect = 7.3 Identities = 27/92 (29%), Positives = 32/92 (34%) Frame = +3 Query: 171 ATPVPQVTPQSARPPVDLSGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKLNI 350 A P P + PP D S L + P S P P PL P L Sbjct: 28 AAPPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPP--PPPLDSSPPPPPDLT- 84 Query: 351 MIKTSPKSPPRTEAEPHRRFEFPPADPCNAEP 446 P SPP +A P FPP P ++ P Sbjct: 85 ---PPPSSPPPPDAPPPIPIVFPP--PIDSPP 111 >At1g16710.1 68414.m02003 TAZ zinc finger family protein / zinc finger (ZZ type) family protein contains Pfam profiles PF02135: TAZ zinc finger, PF00569: Zinc finger, ZZ type Length = 1706 Score = 27.9 bits (59), Expect = 7.3 Identities = 19/60 (31%), Positives = 24/60 (40%) Frame = -1 Query: 589 AGLCKGSFLTNGREDMDRLFCGLSSTSSMNLCSANAHNNPKPPRAGFAGSALQGSAGGNS 410 AG G ++NG + R F L S SM A P GF S ++GG S Sbjct: 201 AGGMHGGNMSNGYQHSSRNF-SLGSGGSMTSMGAQRSTAQMIPTPGFVNSVTNNNSGGFS 259 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 330 PTSKLNIMIKT-SPKSPPRTEAEPHRRFEFPPADPCNAEPAKP 455 P+SK++ ++ SP PP ++ P R +PP P + P P Sbjct: 428 PSSKMSPSVRAYSPPPPPYSKMSPSVR-AYPPPPPPSPSPPPP 469 >At5g66050.1 68418.m08319 expressed protein Length = 340 Score = 27.5 bits (58), Expect = 9.6 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -1 Query: 505 MNLCSANAHNNPKPPRAGFAGSALQGSAGGNSNLLCGSASVL 380 +NL S +H PK GS++ GS G+ +L ASVL Sbjct: 48 LNLKSLRSHRRPKISHICCDGSSISGSGLGDPDLEFLQASVL 89 >At5g45275.1 68418.m05557 expressed protein Requires functional assignment. Length = 570 Score = 27.5 bits (58), Expect = 9.6 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -1 Query: 301 SKEGMLVPGVVLSNCSMLFERSSNPLRST-GGLALWGVTCGTGVALAVSITSSLVEP 134 ++ G L ++ + ++ SS L + G AL G++ G A AVSITS L P Sbjct: 420 ARTGWLAVALLPTTIALFLLASSGSLAALQAGTALIGLSSGFIFAAAVSITSELFGP 476 >At4g30260.1 68417.m04302 integral membrane Yip1 family protein contains Pfam domain, PF04893: Yip1 domain Length = 280 Score = 27.5 bits (58), Expect = 9.6 Identities = 15/69 (21%), Positives = 29/69 (42%) Frame = +3 Query: 225 SGLELLSNSIEQFERTTPGTSMPSLEPVPLTVDTRPTSKLNIMIKTSPKSPPRTEAEPHR 404 S ++ + N + ++ PGT +P+ P P+ + P S + P PP + + + Sbjct: 15 SDIDEIENMMNDSFQSGPGTVLPARPPSPIR-PSIPVSSSPFVQSNLPPLPPSSSSSTQK 73 Query: 405 RFEFPPADP 431 P P Sbjct: 74 VMPVPAPPP 82 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = -1 Query: 487 NAHNNPKPPRAGFAGSALQGSAGGNSNLLCGSASVLGGDFGEVL 356 +A+NNP+ R G G GG+ +L+ G+ + +GG +V+ Sbjct: 337 HAYNNPRYQRNDNNG---YGPPGGHGHLMAGNPAGMGGPTAQVI 377 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = -1 Query: 487 NAHNNPKPPRAGFAGSALQGSAGGNSNLLCGSASVLGGDFGEVL 356 +A+NNP+ R G G GG+ +L+ G+ + +GG +V+ Sbjct: 337 HAYNNPRYQRNDNNG---YGPPGGHGHLMAGNPAGMGGPTAQVI 377 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = -1 Query: 487 NAHNNPKPPRAGFAGSALQGSAGGNSNLLCGSASVLGGDFGEVL 356 +A+NNP+ R G G GG+ +L+ G+ + +GG +V+ Sbjct: 337 HAYNNPRYQRNDNNG---YGPPGGHGHLMAGNPAGMGGPTAQVI 377 >At2g33290.1 68415.m04080 SET domain-containing protein (SUVH2) identical to SUVH2 [Arabidopsis thaliana] GI:13517745; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain; identical to cDNA SUVH2 (SUVH2) GI:13517744 Length = 651 Score = 27.5 bits (58), Expect = 9.6 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -1 Query: 256 SMLFERSSNPLRSTG--GLALWGVTCGTGVALAVSITSSLVEPP 131 S LF + PL+ G G++++G+ G VA+ L+EPP Sbjct: 68 SELFRSAFKPLQVKGLDGVSVYGLDSGAIVAVPEKENRELIEPP 111 >At1g70320.1 68414.m08090 ubiquitin-protein ligase 2 (UPL2) nearly identical to ubiquitin-protein ligase 2 [Arabidopsis thaliana] GI:7108523; E3, HECT-domain protein family; similar to ubiquitin-protein ligase 2 GI:7108523 from [Arabidopsis thaliana] Length = 3658 Score = 27.5 bits (58), Expect = 9.6 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = +3 Query: 90 DAIERDDTMDN---LSSGGSTNELVI-DTARATPVPQVTPQSARPPVDLSGLELLSNSIE 257 D ++ DD + LS G S+ + DT + VPQ + PPVD E+++ S++ Sbjct: 1315 DPVQEDDELAQALALSLGNSSETPKLEDTEKPVDVPQEEAEPKEPPVD----EVIAASVK 1370 Query: 258 QFE 266 F+ Sbjct: 1371 LFQ 1373 >At1g13470.1 68414.m01578 expressed protein Length = 379 Score = 27.5 bits (58), Expect = 9.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 438 HCKDQLVGTQIFCAVLLQSWEEI 370 + KDQL + + +LLQ WEE+ Sbjct: 224 NAKDQLKSSAYYSMILLQRWEEV 246 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,225,441 Number of Sequences: 28952 Number of extensions: 333157 Number of successful extensions: 1284 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 1172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1266 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -