BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0679 (791 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.5 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 22 5.7 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 7.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 7.5 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 9.9 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 9.9 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 9.9 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 9.9 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 2.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 99 AVVVDSVLRRVLYEHGGGRVRLSSPYEYR 13 A +V+S LR ++ GRV +P+E+R Sbjct: 961 AFIVNSNLRLTFSKNVQGRVGFVTPFEHR 989 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 22.2 bits (45), Expect = 5.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 524 INNKLSKWCNIINSKE*RWA 583 I NK++ W N++ + E WA Sbjct: 149 IANKINSWDNVVVAYEPVWA 168 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 7.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 339 NAASDPTAETTIVSDELVRSDGADNERARQTG 434 NA DPT E E +R+D N + +G Sbjct: 1336 NAVGDPTREWYKGQGEQIRTDSTRNIQILPSG 1367 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 7.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 339 NAASDPTAETTIVSDELVRSDGADNERARQTG 434 NA DPT E E +R+D N + +G Sbjct: 1332 NAVGDPTREWYKGQGEQIRTDSTRNIQILPSG 1363 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 9.9 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -2 Query: 436 EPVCLARSLSAPSDRTSSSLTIVVSAVGSDAAFC 335 E C+ +S +A + ++ LTI V A C Sbjct: 124 EAFCIIQSFAAETSANATVLTITAFTVERYIAIC 157 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 9.9 Identities = 15/59 (25%), Positives = 23/59 (38%) Frame = +1 Query: 142 ASADGISKAPRPLSNILPSGGIRPNSNVSTQTXXXXXXXXXKQRGKPGVRSPAPANKQD 318 A++ + P +N PS R S S+ T G+P R+ NKQ+ Sbjct: 494 AASTAVIHEPVVETNSSPSPNPRIASAPSSSTSSSPPAKGAAAAGQPSKRNGGETNKQE 552 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.4 bits (43), Expect = 9.9 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +2 Query: 617 GCHKPYQWCN 646 GC P+QW N Sbjct: 411 GCRTPFQWDN 420 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 679 RYNSRAAEHNTDRAK 723 +YN+RA H T AK Sbjct: 536 QYNTRAENHQTGTAK 550 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.312 0.124 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,065 Number of Sequences: 438 Number of extensions: 3440 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -