BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0677 (576 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457558-1|AAL68788.1| 56|Anopheles gambiae hypothetical prote... 24 3.1 AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 24 4.1 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 7.1 >AF457558-1|AAL68788.1| 56|Anopheles gambiae hypothetical protein 11 protein. Length = 56 Score = 24.2 bits (50), Expect = 3.1 Identities = 9/24 (37%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +1 Query: 340 MCMCYNSHIVFVILVMCYLFY-TH 408 MC+ + + I ++L++C FY TH Sbjct: 1 MCIFFQAGIKLLVLLICLFFYHTH 24 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 23.8 bits (49), Expect = 4.1 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +1 Query: 61 VSDSLSFVLLMLPAGPTNVLFCYSLPTKPISILTPLLCTRSDCGIRCRLTSE 216 V D ++FVL+MLP V+ C + + ++T + C+ C + R+T E Sbjct: 183 VEDYITFVLIMLPV----VVMCGYVCN--LKVMT-ICCSIGHCTLYTRMTIE 227 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +3 Query: 294 TLRIYECYCVTYNIC 338 T+ I +CYCV+++ C Sbjct: 809 TICIEKCYCVSFSRC 823 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 590,653 Number of Sequences: 2352 Number of extensions: 12364 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -