BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0677 (576 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-3156|AAF49157.1| 728|Drosophila melanogaster CG9472-PA... 30 2.0 AY118366-1|AAM48395.1| 2118|Drosophila melanogaster RE10379p pro... 29 4.5 AL022018-1|CAA17682.1| 2118|Drosophila melanogaster EG:8D8.1 pro... 29 4.5 AE014298-177|AAF45603.1| 2118|Drosophila melanogaster CG11411-PA... 29 4.5 >AE014296-3156|AAF49157.1| 728|Drosophila melanogaster CG9472-PA protein. Length = 728 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/73 (24%), Positives = 33/73 (45%) Frame = +3 Query: 147 NFYSHSFTVHAVRLWNSLPADIRVCKSVSVFKYKVKQFYLSSTE*SWFYTLRIYECYCVT 326 N H F + + L +D R KS+ + Y +K+ +L + + F +Y T Sbjct: 277 NHVGHMFNYPESKGYKVLLSDTRH-KSLKIIDYLMKKNWLDANTTALFMDFSLYNADANT 335 Query: 327 YNICYVYVL*FSY 365 + +C ++V F Y Sbjct: 336 FTVCTLWVEKFPY 348 >AY118366-1|AAM48395.1| 2118|Drosophila melanogaster RE10379p protein. Length = 2118 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +3 Query: 57 LRERFSFI-RSPDAPCRSNQRSVLLFPSHKTNFYSHSFTVHAVRLWN 194 L + F F+ P RS + +LL H+ F +HS V V +WN Sbjct: 404 LGQNFGFVDHYLPIPVRSYRDDLLLLVQHRVVFDTHSLLVLEVLVWN 450 >AL022018-1|CAA17682.1| 2118|Drosophila melanogaster EG:8D8.1 protein. Length = 2118 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +3 Query: 57 LRERFSFI-RSPDAPCRSNQRSVLLFPSHKTNFYSHSFTVHAVRLWN 194 L + F F+ P RS + +LL H+ F +HS V V +WN Sbjct: 404 LGQNFGFVDHYLPIPVRSYRDDLLLLVQHRVVFDTHSLLVLEVLVWN 450 >AE014298-177|AAF45603.1| 2118|Drosophila melanogaster CG11411-PA protein. Length = 2118 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +3 Query: 57 LRERFSFI-RSPDAPCRSNQRSVLLFPSHKTNFYSHSFTVHAVRLWN 194 L + F F+ P RS + +LL H+ F +HS V V +WN Sbjct: 404 LGQNFGFVDHYLPIPVRSYRDDLLLLVQHRVVFDTHSLLVLEVLVWN 450 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,742,960 Number of Sequences: 53049 Number of extensions: 478749 Number of successful extensions: 1185 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1185 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2276053890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -