BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0677 (576 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 23 2.9 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 22 3.8 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 22 3.8 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 5.0 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 22 5.0 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 6.6 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 22.6 bits (46), Expect = 2.9 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 3/96 (3%) Frame = +1 Query: 73 LSFVLLMLPAGPTNVLFCYSLPTKPISILTPLLCTRSDCGIRCRLTSEFASLFLFLNTRS 252 L+ + + + AG V ++ I IL +L +D G R T F++ + Sbjct: 73 LNKLAVFIVAGAVGVFSVLTILISYIYILMAILRMSADGGCRNFSTCSSHPTAAFISYGT 132 Query: 253 NNFIYHQPNDHGSI-LFAYTSV--TVLLIIFAMCMC 351 FIY QP+ S+ L SV T ++ +F+ +C Sbjct: 133 LFFIYVQPSATFSLDLNKVVSVFYTAVIPMFSPFIC 168 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 22.2 bits (45), Expect = 3.8 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +1 Query: 322 LLIIFAMCMCYNS 360 +++IFA C+C N+ Sbjct: 4 IVVIFAFCICVNA 16 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 22.2 bits (45), Expect = 3.8 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +1 Query: 322 LLIIFAMCMCYNS 360 +++IFA C+C N+ Sbjct: 4 IVVIFAFCICVNA 16 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 423 YYSHYPLAGLLEEISQRNKQ 482 YY+ LAG ++E +Q+ +Q Sbjct: 221 YYAQVNLAGYIQEQNQQQQQ 240 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 346 MCYNSHIVFVILVMC 390 M YN+ + +IL+MC Sbjct: 1 MLYNNLTIVIILIMC 15 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 387 HN*NNKYNMRIIAHTHSKYYK 325 +N NNKYN + YYK Sbjct: 98 YNYNNKYNYNNNNYNKKLYYK 118 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,241 Number of Sequences: 438 Number of extensions: 3774 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -