BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0674 (651 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-560|AAN11529.1| 1035|Drosophila melanogaster CG14955-PB... 29 5.5 AE014296-559|AAF47715.2| 938|Drosophila melanogaster CG14955-PA... 29 5.5 >AE014296-560|AAN11529.1| 1035|Drosophila melanogaster CG14955-PB, isoform B protein. Length = 1035 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 448 ISKPRHNYMF--SVFNTLLLALPVCTHFGRQRLGSAR 552 I+KP + F +F++LLL CTHF R RL S + Sbjct: 680 IAKPMNAIWFWLLLFSSLLLPTICCTHFLRSRLNSLK 716 >AE014296-559|AAF47715.2| 938|Drosophila melanogaster CG14955-PA, isoform A protein. Length = 938 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 448 ISKPRHNYMF--SVFNTLLLALPVCTHFGRQRLGSAR 552 I+KP + F +F++LLL CTHF R RL S + Sbjct: 583 IAKPMNAIWFWLLLFSSLLLPTICCTHFLRSRLNSLK 619 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,656,030 Number of Sequences: 53049 Number of extensions: 507314 Number of successful extensions: 1467 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1467 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2765538900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -