BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0672 (571 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 25 0.40 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 2.8 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 22 3.7 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 22 3.7 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 3.7 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 6.5 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 6.5 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 21 8.6 S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. 21 8.6 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 8.6 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 8.6 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 8.6 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 8.6 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 25.4 bits (53), Expect = 0.40 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = -2 Query: 567 SSFLQRFVNCY-PIHIRVINEPN-DLIREQFSIVLTGEVRF 451 SSF Q+F +CY P+ +PN D IR ++ R+ Sbjct: 420 SSFFQQFFHCYCPVRFGRKADPNGDYIRRYLPVLKNFPTRY 460 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.6 bits (46), Expect = 2.8 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = +2 Query: 164 YSFVGVITILTTS 202 YS++GV+T++ TS Sbjct: 641 YSYIGVLTLVATS 653 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -2 Query: 366 GHRLLNKRFATGEPVTVCTVQVIGQINGDQQTG 268 GHR K TG C V ++ G+ + G Sbjct: 21 GHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 53 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -2 Query: 366 GHRLLNKRFATGEPVTVCTVQVIGQINGDQQTG 268 GHR K TG C V ++ G+ + G Sbjct: 37 GHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 69 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -2 Query: 366 GHRLLNKRFATGEPVTVCTVQVIGQINGDQQTG 268 GHR K TG C V ++ G+ + G Sbjct: 94 GHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 126 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 6.5 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 52 ADILLFSAYKWNVSRPSLLADTKDTMDNTTT 144 AD A+ NVSR S +D K +DN T Sbjct: 302 ADFPFNFAFIKNVSRDSNSSDFKKLVDNWMT 332 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 6.5 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 52 ADILLFSAYKWNVSRPSLLADTKDTMDNTTT 144 AD A+ NVSR S +D K +DN T Sbjct: 302 ADFPFNFAFIKNVSRDSNSSDFKKLIDNWMT 332 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -2 Query: 366 GHRLLNKRFATGEPVTVCTVQVIGQINGDQQTG 268 GHR K TG C V ++ G+ + G Sbjct: 94 GHRDFIKNMITGTSQADCAVLIVAAGIGEFEAG 126 >S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. Length = 46 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -2 Query: 186 VITPTKLYIKPVLLCSC 136 VI T ++ PV+ C+C Sbjct: 14 VILITSYFVTPVMPCNC 30 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 36 DEFIMRRYITVLSLQVERV 92 D +I R YI VLS +++++ Sbjct: 370 DRYINREYILVLSNKMQKM 388 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 550 VCELLPDTHSCHQRTK*FD*RTILHS 473 +C+LL D+ ++T+ D LHS Sbjct: 679 ICQLLKDSQYIREQTESDDKEGYLHS 704 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 36 DEFIMRRYITVLSLQVERV 92 D +I R YI VLS +++++ Sbjct: 370 DRYINREYILVLSNKMQKM 388 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 36 DEFIMRRYITVLSLQVERV 92 D +I R YI VLS +++++ Sbjct: 370 DRYINREYILVLSNKMQKM 388 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,811 Number of Sequences: 438 Number of extensions: 4003 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -