BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0668 (775 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 4.7 AF264718-1|AAF75271.1| 125|Tribolium castaneum putative cytochr... 21 8.3 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.2 bits (45), Expect = 4.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 116 HEIYPFFLRSTSSTLPYVLQFDRPIS*N**KSYTSI 223 ++IY F L +T + L + DRP KSYT I Sbjct: 23 NKIYSFLLLTTLTLLVILSSIDRPYL----KSYTYI 54 >AF264718-1|AAF75271.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q6 protein. Length = 125 Score = 21.4 bits (43), Expect = 8.3 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 495 VKIGPAVPEISRNKHTDRETKIVKNVILVYVPYVYIF 385 +++ P+VP ISR D TK + V +++IF Sbjct: 55 LRLFPSVPFISRYASEDFVTKTGNTIPEGTVLHIHIF 91 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,109 Number of Sequences: 336 Number of extensions: 3591 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -