BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0668 (775 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00780.1 68417.m00108 meprin and TRAF homology domain-contain... 28 7.9 At1g58090.1 68414.m06583 F-box family protein contains F-box dom... 28 7.9 >At4g00780.1 68417.m00108 meprin and TRAF homology domain-containing protein / MATH domain-containing protein contains Pfam profile PF00917: MATH domain Length = 299 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -2 Query: 579 VTPRGEASVKKVSLSYSLYHQLPVSESPVKIGPAVPEISRNKHT 448 V P G + K +S L +Q+PV++ P V ++ R HT Sbjct: 56 VYPNGHKNAKGTHVSMFLVNQVPVNDMPTYELLVVSQLERKWHT 99 >At1g58090.1 68414.m06583 F-box family protein contains F-box domain Pfam:PF00646 Length = 371 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 157 CRRGRPKKKWIDFVKDDMCKR 95 C RPK W+ V+ D+CK+ Sbjct: 328 CPSKRPKAAWVYIVRGDLCKK 348 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,692,632 Number of Sequences: 28952 Number of extensions: 285247 Number of successful extensions: 706 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -