BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0666 (630 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0678 - 5103836-5104613,5104697-5104888,5104994-5105036,510... 31 0.75 12_02_1286 - 27555143-27555191,27555290-27555511,27555911-275561... 29 2.3 02_02_0525 - 11182043-11182080,11182386-11182511,11182760-11183486 28 5.3 >07_01_0678 - 5103836-5104613,5104697-5104888,5104994-5105036, 5105712-5105835,5105924-5106016,5106754-5106931, 5107032-5107138,5108098-5108179,5108277-5108314, 5108409-5108495,5109025-5109135,5109282-5109773 Length = 774 Score = 31.1 bits (67), Expect = 0.75 Identities = 23/64 (35%), Positives = 28/64 (43%), Gaps = 7/64 (10%) Frame = -3 Query: 520 RLLRICNSVPE---PRI*SRTRRSCSAGPGTVGARNSVNCSART----DPSSPVSNLN*F 362 RL R CNS P+ P R RR +AG G GA S C T +P +P Sbjct: 90 RLPRACNSKPKPPPPPPPERPRRRAAAGGGAGGAEESPQCRVVTPLVSEPEAPAEMPRWR 149 Query: 361 LSCL 350 L C+ Sbjct: 150 LRCM 153 >12_02_1286 - 27555143-27555191,27555290-27555511,27555911-27556162, 27556683-27557062,27557202-27557311,27557864-27558033, 27558236-27558444,27558528-27558617,27559125-27559264, 27559356-27559463,27559626-27559716,27560736-27560852, 27561497-27561767,27561892-27562193,27562400-27562469, 27563464-27563702,27564613-27564846,27564943-27565179, 27565276-27565734 Length = 1249 Score = 29.5 bits (63), Expect = 2.3 Identities = 20/72 (27%), Positives = 34/72 (47%) Frame = +3 Query: 309 ARPSKYEFPVQNGGRQERNQFRFDTGELGSVRALQFTEFRAPTVPGPAEQLLRVRLYIRG 488 AR +K++ + ++++NQ+ + ELGS R LQ E E+ L Y+ Sbjct: 698 ARSNKWDDSIIESWKKKKNQYESEMSELGSPRELQRKELAVSEKITGLEKKLH---YLNV 754 Query: 489 SGTELQMRSRRL 524 L+ + RRL Sbjct: 755 EENNLREKLRRL 766 >02_02_0525 - 11182043-11182080,11182386-11182511,11182760-11183486 Length = 296 Score = 28.3 bits (60), Expect = 5.3 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -2 Query: 617 AGT*SRIEDAVSPRPAG*RTAARNVSLNLNSQPSTSHL 504 AG+ S + SP PA TAA + LNLN P +HL Sbjct: 208 AGSSSTTTTSASPPPAP-ATAATALDLNLNLPPPLAHL 244 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,503,639 Number of Sequences: 37544 Number of extensions: 327390 Number of successful extensions: 625 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1537558360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -