BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0666 (630 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_36474| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.021 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.083 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 33 0.25 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 32 0.33 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 32 0.33 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 32 0.33 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 32 0.33 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 32 0.33 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 32 0.33 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 32 0.33 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 32 0.33 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 32 0.33 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 32 0.33 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 32 0.33 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 32 0.33 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 32 0.33 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 32 0.33 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 32 0.33 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 32 0.33 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 32 0.33 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 32 0.33 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 32 0.33 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 32 0.33 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 32 0.33 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 32 0.33 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 32 0.33 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 32 0.33 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 32 0.33 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 32 0.33 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 32 0.33 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 32 0.33 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 32 0.33 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 32 0.33 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 32 0.33 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 32 0.33 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 32 0.33 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 32 0.33 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 32 0.33 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 32 0.33 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 32 0.33 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 32 0.33 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 32 0.33 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 32 0.33 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 32 0.33 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 32 0.33 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 32 0.33 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 32 0.33 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 32 0.33 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 32 0.33 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 32 0.33 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 32 0.33 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_42545| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 32 0.33 SB_42077| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 32 0.33 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 32 0.33 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) 32 0.33 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 32 0.33 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 32 0.33 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_37896| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_37019| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 32 0.33 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36228| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 32 0.33 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 32 0.33 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 32 0.33 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_33093| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 32 0.33 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 32 0.33 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_31520| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 >SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = -3 Query: 103 IKPSLTPSLVPNYLQPGGXTSXRAAAT 23 ++PSL P++ +LQPGG TS RAAAT Sbjct: 1 MRPSLAPNVTIEFLQPGGSTSSRAAAT 27 >SB_36474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1608 Score = 36.3 bits (80), Expect = 0.021 Identities = 21/57 (36%), Positives = 30/57 (52%) Frame = -3 Query: 517 LLRICNSVPEPRI*SRTRRSCSAGPGTVGARNSVNCSARTDPSSPVSNLN*FLSCLP 347 L+ + NSVP ++ + S G G A S+ S T PSSP++NL LS +P Sbjct: 299 LVSLLNSVPASQLAGKRIGMFSYGSGLASAMFSIRVSPNTSPSSPLTNLVGSLSDVP 355 >SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 34.7 bits (76), Expect = 0.063 Identities = 21/38 (55%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -3 Query: 133 PPVSFMN*LTIKPSLTPSLVP-NYLQPGGXTSXRAAAT 23 PPVS + P TPS P +LQPGG TS RAAAT Sbjct: 4 PPVSTPS--NTPPVSTPSHTPIEFLQPGGSTSSRAAAT 39 >SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 34.3 bits (75), Expect = 0.083 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 Query: 91 LTPSLVPNYLQPGGXTSXRAAAT 23 L PS++ +LQPGG TS RAAAT Sbjct: 34 LPPSVIIEFLQPGGSTSSRAAAT 56 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.9 bits (74), Expect = 0.11 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +3 Query: 24 VAAALXLVXPPGCR*FGTRDGV-SDGLIVS*FINETGGAIKLKKKVAICLSIL 179 VAAAL LV PPGCR T+D + +++ +I G ++ +K+VA + +L Sbjct: 9 VAAALELVDPPGCRNSITKDKMYGRNELIARYILMKTGKMRTRKQVASHIQVL 61 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +3 Query: 24 VAAALXLVXPPGCR*FGTRDGVSDG 98 VAAAL LV PPGCR +GVSDG Sbjct: 26 VAAALELVDPPGCRNSIDGNGVSDG 50 >SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -3 Query: 106 TIKPSLTPSLVPNYLQPGGXTSXRAAAT 23 T+KP + + +LQPGG TS RAAAT Sbjct: 14 TLKPKMHDQIHIEFLQPGGSTSSRAAAT 41 >SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.1 bits (72), Expect = 0.19 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -3 Query: 100 KPSLTPSLVPNYLQPGGXTSXRAAAT 23 KPS+ P + +LQPGG TS RAAAT Sbjct: 7 KPSMCPPI--EFLQPGGSTSSRAAAT 30 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 32.7 bits (71), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 67 YLQPGGXTSXRAAATXGG 14 +LQPGG TS RAAAT GG Sbjct: 22 FLQPGGSTSSRAAATVGG 39 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 32.7 bits (71), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 67 YLQPGGXTSXRAAATXGG 14 +LQPGG TS RAAAT GG Sbjct: 35 FLQPGGSTSSRAAATAGG 52 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 14 SCSPGDPLVLERPPPRWSS 32 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 12 SCSPGDPLVLERPPPRWSS 30 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 37 SCSPGDPLVLERPPPRWSS 55 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 28 SCSPGDPLVLERPPPRWSS 46 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 5 SCSPGDPLVLERPPPRWSS 23 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 20 SCSPGDPLVLERPPPRWSS 38 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 29 SCSPGDPLVLERPPPRWSS 47 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 186 SCSPGDPLVLERPPPRWSS 204 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 81 SCSPGDPLVLERPPPRWSS 99 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 17 SCSPGDPLVLERPPPRWSS 35 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 351 SCSPGDPLVLERPPPRWSS 369 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 9 SCSPGDPLVLERPPPRWSS 27 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 8 SCSPGDPLVLERPPPRWSS 26 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 20 SCSPGDPLVLERPPPRWSS 38 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 29 SCSPGDPLVLERPPPRWSS 47 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 13 SCSPGDPLVLERPPPRWSS 31 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 104 SCSPGDPLVLERPPPRWSS 122 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 33 SCSPGDPLVLERPPPRWSS 51 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 9 SCSPGDPLVLERPPPRWSS 27 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 37 SCSPGDPLVLERPPPRWSS 55 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 6 SCSPGDPLVLERPPPRWSS 24 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 84 SCSPGDPLVLERPPPRWSS 102 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 4 SCSPGDPLVLERPPPRWSS 22 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 518 SCSPGDPLVLERPPPRWSS 536 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 384 SCSPGDPLVLERPPPRWSS 402 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 26 SCSPGDPLVLERPPPRWSS 44 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 16 SCSPGDPLVLERPPPRWSS 34 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 24 SCSPGDPLVLERPPPRWSS 42 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 33 SCSPGDPLVLERPPPRWSS 51 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 4 SCSPGDPLVLERPPPRWSS 22 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 10 SCSPGDPLVLERPPPRWSS 28 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 24 SCSPGDPLVLERPPPRWSS 42 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 21 SCSPGDPLVLERPPPRWSS 39 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 5 SCSPGDPLVLERPPPRWSS 23 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 19 SCSPGDPLVLERPPPRWSS 37 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 9 SCSPGDPLVLERPPPRWSS 27 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 56 SCSPGDPLVLERPPPRWSS 74 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 6 SCSPGDPLVLERPPPRWSS 24 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 264 SCSPGDPLVLERPPPRWSS 282 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 27 SCSPGDPLVLERPPPRWSS 45 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 21 SCSPGDPLVLERPPPRWSS 39 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 13 SCSPGDPLVLERPPPRWSS 31 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 13 SCSPGDPLVLERPPPRWSS 31 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 13 SCSPGDPLVLERPPPRWSS 31 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 21 SCSPGDPLVLERPPPRWSS 39 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 15 SCSPGDPLVLERPPPRWSS 33 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 165 SCSPGDPLVLERPPPRWSS 183 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 22 SCSPGDPLVLERPPPRWSS 40 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 23 SCSPGDPLVLERPPPRWSS 41 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 19 SCSPGDPLVLERPPPRWSS 37 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 37 SCSPGDPLVLERPPPRWSS 55 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 20 SCSPGDPLVLERPPPRWSS 38 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 66 SCSPGDPLVLERPPPRWSS 84 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 19 SCSPGDPLVLERPPPRWSS 37 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 18 SCSPGDPLVLERPPPRWSS 36 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 7 SCSPGDPLVLERPPPRWSS 25 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 6 SCSPGDPLVLERPPPRWSS 24 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 13 SCSPGDPLVLERPPPRWSS 31 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 50 SCSPGDPLVLERPPPRWSS 68 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 15 SCSPGDPLVLERPPPRWSS 33 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 115 SCSPGDPLVLERPPPRWSS 133 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 895 SCSPGDPLVLERPPPRWSS 913 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 16 SCSPGDPLVLERPPPRWSS 34 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 27 SCSPGDPLVLERPPPRWSS 45 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 16 SCSPGDPLVLERPPPRWSS 34 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 45 SCSPGDPLVLERPPPRWSS 63 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 96 SCSPGDPLVLERPPPRWSS 114 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 67 SCSPGDPLVLERPPPRWSS 85 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 17 SCSPGDPLVLERPPPRWSS 35 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 878 SCSPGDPLVLERPPPRWSS 896 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 9 SCSPGDPLVLERPPPRWSS 27 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 13 SCSPGDPLVLERPPPRWSS 31 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 65 SCSPGDPLVLERPPPRWSS 83 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 7 SCSPGDPLVLERPPPRWSS 25 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 20 SCSPGDPLVLERPPPRWSS 38 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 22 SCSPGDPLVLERPPPRWSS 40 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 66 SCSPGDPLVLERPPPRWSS 84 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 45 SCSPGDPLVLERPPPRWSS 63 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 28 SCSPGDPLVLERPPPRWSS 46 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 41 SCSPGDPLVLERPPPRWSS 59 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 17 SCSPGDPLVLERPPPRWSS 35 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 23 SCSPGDPLVLERPPPRWSS 41 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 26 SCSPGDPLVLERPPPRWSS 44 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 43 SCSPGDPLVLERPPPRWSS 61 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 5 SCSPGDPLVLERPPPRWSS 23 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 42 SCSPGDPLVLERPPPRWSS 60 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 27 SCSPGDPLVLERPPPRWSS 45 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 17 SCSPGDPLVLERPPPRWSS 35 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 144 SCSPGDPLVLERPPPRWSS 162 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 485 SCSPGDPLVLERPPPRWSS 503 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 4 SCSPGDPLVLERPPPRWSS 22 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 37 SCSPGDPLVLERPPPRWSS 55 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 83 SCSPGDPLVLERPPPRWSS 101 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 38 SCSPGDPLVLERPPPRWSS 56 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 63 SCSPGDPLVLERPPPRWSS 81 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 26 SCSPGDPLVLERPPPRWSS 44 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 6 SCSPGDPLVLERPPPRWSS 24 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 6 SCSPGDPLVLERPPPRWSS 24 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 56 SCSPGDPLVLERPPPRWSS 74 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 9 SCSPGDPLVLERPPPRWSS 27 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 4 SCSPGDPLVLERPPPRWSS 22 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 25 SCSPGDPLVLERPPPRWSS 43 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 24 SCSPGDPLVLERPPPRWSS 42 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 36 SCSPGDPLVLERPPPRWSS 54 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 4 SCSPGDPLVLERPPPRWSS 22 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 206 SCSPGDPLVLERPPPRWSS 224 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 49 SCSPGDPLVLERPPPRWSS 67 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 16 SCSPGDPLVLERPPPRWSS 34 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 4 SCSPGDPLVLERPPPRWSS 22 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 5 SCSPGDPLVLERPPPRWSS 23 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 1024 SCSPGDPLVLERPPPRWSS 1042 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 19 SCSPGDPLVLERPPPRWSS 37 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 19 SCSPGDPLVLERPPPRWSS 37 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 123 SCSPGDPLVLERPPPRWSS 141 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 19 SCSPGDPLVLERPPPRWSS 37 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 6 SCSPGDPLVLERPPPRWSS 24 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 25 SCSPGDPLVLERPPPRWSS 43 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 14 SCSPGDPLVLERPPPRWSS 32 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 10 SCSPGDPLVLERPPPRWSS 28 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 65 SCSPGDPLVLERPPPRWSS 83 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 25 SCSPGDPLVLERPPPRWSS 43 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 11 SCSPGDPLVLERPPPRWSS 29 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 7 SCSPGDPLVLERPPPRWSS 25 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 194 SCSPGDPLVLERPPPRWSS 212 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 45 SCSPGDPLVLERPPPRWSS 63 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 26 SCSPGDPLVLERPPPRWSS 44 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 32 SCSPGDPLVLERPPPRWSS 50 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 41 SCSPGDPLVLERPPPRWSS 59 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 24 SCSPGDPLVLERPPPRWSS 42 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 41 SCSPGDPLVLERPPPRWSS 59 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 18 SCSPGDPLVLERPPPRWSS 36 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 19 SCSPGDPLVLERPPPRWSS 37 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 62 SCSPGDPLVLERPPPRWSS 80 >SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 8 SCSPGDPLVLERPPPRWSS 26 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 86 SCSPGDPLVLERPPPRWSS 104 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 22 SCSPGDPLVLERPPPRWSS 40 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 15 SCSPGDPLVLERPPPRWSS 33 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 21 SCSPGDPLVLERPPPRWSS 39 >SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 7 SCSPGDPLVLERPPPRWSS 25 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 6 SCSPGDPLVLERPPPRWSS 24 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 21 SCSPGDPLVLERPPPRWSS 39 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 12 SCSPGDPLVLERPPPRWSS 30 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 53 SCSPGDPLVLERPPPRWSS 71 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 43 SCSPGDPLVLERPPPRWSS 61 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 13 SCSPGDPLVLERPPPRWSS 31 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 11 SCSPGDPLVLERPPPRWSS 29 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 120 SCSPGDPLVLERPPPRWSS 138 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 69 SCSPGDPLVLERPPPRWSS 87 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 244 SCSPGDPLVLERPPPRWSS 262 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 15 SCSPGDPLVLERPPPRWSS 33 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 187 SCSPGDPLVLERPPPRWSS 205 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 6 SCSPGDPLVLERPPPRWSS 24 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 10 SCSPGDPLVLERPPPRWSS 28 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 17 SCSPGDPLVLERPPPRWSS 35 >SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) Length = 608 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 8 SCSPGDPLVLERPPPRWSS 26 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 24 SCSPGDPLVLERPPPRWSS 42 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 11 SCSPGDPLVLERPPPRWSS 29 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 25 SCSPGDPLVLERPPPRWSS 43 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 20 SCSPGDPLVLERPPPRWSS 38 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 37 SCSPGDPLVLERPPPRWSS 55 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 66 SCSPGDPLVLERPPPRWSS 84 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 59 SCSPGDPLVLERPPPRWSS 77 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 59 SCSPGDPLVLERPPPRWSS 77 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 19 SCSPGDPLVLERPPPRWSS 37 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 11 SCSPGDPLVLERPPPRWSS 29 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 1069 SCSPGDPLVLERPPPRWSS 1087 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 137 SCSPGDPLVLERPPPRWSS 155 >SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 80 SCSPGDPLVLERPPPRWSS 98 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 16 SCSPGDPLVLERPPPRWSS 34 >SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 7 SCSPGDPLVLERPPPRWSS 25 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 93 SCSPGDPLVLERPPPRWSS 111 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 14 SCSPGDPLVLERPPPRWSS 32 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 7 SCSPGDPLVLERPPPRWSS 25 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 159 SCSPGDPLVLERPPPRWSS 177 >SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 5 SCSPGDPLVLERPPPRWSS 23 >SB_14086| Best HMM Match : POR (HMM E-Value=7.7) Length = 292 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 171 SCSPGDPLVLERPPPRWSS 189 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 23 SCSPGDPLVLERPPPRWSS 41 >SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 36 SCSPGDPLVLERPPPRWSS 54 >SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 8 SCSPGDPLVLERPPPRWSS 26 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 18 SCSPGDPLVLERPPPRWSS 36 >SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 9 SCSPGDPLVLERPPPRWSS 27 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 55 SCSPGDPLVLERPPPRWSS 73 >SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 18 SCSPGDPLVLERPPPRWSS 36 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 54 SCSPGDPLVLERPPPRWSS 72 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 32 SCSPGDPLVLERPPPRWSS 50 >SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) Length = 593 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 139 SCSPGDPLVLERPPPRWSS 157 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 8 SCSPGDPLVLERPPPRWSS 26 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 14 SCSPGDPLVLERPPPRWSS 32 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 19 SCSPGDPLVLERPPPRWSS 37 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 82 SCSPGDPLVLERPPPRWSS 100 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 105 SCSPGDPLVLERPPPRWSS 123 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 74 SCSPGDPLVLERPPPRWSS 92 >SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 73 SCSPGDPLVLERPPPRWSS 91 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 19 SCSPGDPLVLERPPPRWSS 37 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 72 SCSPGDPLVLERPPPRWSS 90 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 69 SCSPGDPLVLERPPPRWSS 87 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 6 SCSPGDPLVLERPPPRWSS 24 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 35 SCSPGDPLVLERPPPRWSS 53 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 14 SCSPGDPLVLERPPPRWSS 32 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 217 SCSPGDPLVLERPPPRWSS 235 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 22 SCSPGDPLVLERPPPRWSS 40 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 11 SCSPGDPLVLERPPPRWSS 29 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 28 SCSPGDPLVLERPPPRWSS 46 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 561 SCSPGDPLVLERPPPRWSS 579 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 13 SCSPGDPLVLERPPPRWSS 31 >SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 10 SCSPGDPLVLERPPPRWSS 28 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 83 SCSPGDPLVLERPPPRWSS 101 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 18 SCSPGDPLVLERPPPRWSS 36 >SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 18 SCSPGDPLVLERPPPRWSS 36 >SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) Length = 141 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 20 SCSPGDPLVLERPPPRWSS 38 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 38 SCSPGDPLVLERPPPRWSS 56 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 81 SCSPGDPLVLERPPPRWSS 99 >SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 4 SCSPGDPLVLERPPPRWSS 22 >SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 8 SCSPGDPLVLERPPPRWSS 26 >SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 5 SCSPGDPLVLERPPPRWSS 23 >SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 13 SCSPGDPLVLERPPPRWSS 31 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 35 SCSPGDPLVLERPPPRWSS 53 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 37 SCSPGDPLVLERPPPRWSS 55 >SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) Length = 129 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 8 SCSPGDPLVLERPPPRWSS 26 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 11 SCSPGDPLVLERPPPRWSS 29 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 163 SCSPGDPLVLERPPPRWSS 181 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 482 SCSPGDPLVLERPPPRWSS 500 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 9 SCSPGDPLVLERPPPRWSS 27 >SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 22 SCSPGDPLVLERPPPRWSS 40 >SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 17 SCSPGDPLVLERPPPRWSS 35 >SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 15 SCSPGDPLVLERPPPRWSS 33 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 27 SCSPGDPLVLERPPPRWSS 45 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 8 SCSPGDPLVLERPPPRWSS 26 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 7 SCSPGDPLVLERPPPRWSS 25 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 3478 SCSPGDPLVLERPPPRWSS 3496 >SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 14 SCSPGDPLVLERPPPRWSS 32 >SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 17 SCSPGDPLVLERPPPRWSS 35 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 7 SCSPGDPLVLERPPPRWSS 25 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 29 SCSPGDPLVLERPPPRWSS 47 >SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 7 SCSPGDPLVLERPPPRWSS 25 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 743 SCSPGDPLVLERPPPRWSS 761 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 113 SCSPGDPLVLERPPPRWSS 131 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 34 SCSPGDPLVLERPPPRWSS 52 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 38 SCSPGDPLVLERPPPRWSS 56 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 66 TCSPGXPLVXERPPXRGES 10 +CSPG PLV ERPP R S Sbjct: 6 SCSPGDPLVLERPPPRWSS 24 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,401,927 Number of Sequences: 59808 Number of extensions: 363218 Number of successful extensions: 3051 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3046 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -