BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0663 (749 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q31IQ0 Cluster: Integrase/transposase family protein; n... 33 5.7 >UniRef50_Q31IQ0 Cluster: Integrase/transposase family protein; n=1; Thiomicrospira crunogena XCL-2|Rep: Integrase/transposase family protein - Thiomicrospira crunogena (strain XCL-2) Length = 636 Score = 33.5 bits (73), Expect = 5.7 Identities = 21/76 (27%), Positives = 37/76 (48%) Frame = -2 Query: 304 FPANSTPLGAFLYSDLECQRTEVVTCLDYSHVRGGLIRPHRLLDRLFIGFRNQLMCIRKT 125 F N LG L D V CL+Y++ +G I HR R+ ++NQ + + Sbjct: 505 FKVNPYDLGEILVFDSRELVYITVPCLEYNYAKGTSIYEHREYKRIARKYKNQKL-NNQD 563 Query: 124 VAMHRLFLENQRDILR 77 + + ++ +N+RD +R Sbjct: 564 LMLAKIRQKNERDKIR 579 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 748,308,243 Number of Sequences: 1657284 Number of extensions: 15219522 Number of successful extensions: 26873 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 26116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26868 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61734884250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -