BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0663 (749 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 2.3 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 7.1 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -3 Query: 411 KFTALFRSPELSNSQHYIQRFIQLFFLVLVKISAKIF 301 K +L R LS Y+ ++ +++FL + + +IF Sbjct: 212 KLLSLVRLLRLSRLVRYVSQWEEVYFLNMASVFMRIF 248 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/51 (21%), Positives = 23/51 (45%) Frame = -3 Query: 468 FVPRLFFFIYHHLAA*IFKKFTALFRSPELSNSQHYIQRFIQLFFLVLVKI 316 F+P + + H + ++ T +F + QH +RF+ + + V I Sbjct: 364 FLPSIEKMVDHETMVPLGERQTLMFSATFPDEVQHLARRFLNNYLFLAVGI 414 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,543 Number of Sequences: 438 Number of extensions: 4856 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -