BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0662 (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 27 0.44 X93562-1|CAA63775.1| 131|Anopheles gambiae defensin protein. 26 1.0 DQ212041-1|ABB00986.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212040-1|ABB00985.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212039-1|ABB00984.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212038-1|ABB00983.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212037-1|ABB00982.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212036-1|ABB00981.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212035-1|ABB00980.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212034-1|ABB00979.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212033-1|ABB00978.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212032-1|ABB00977.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212031-1|ABB00976.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212030-1|ABB00975.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212029-1|ABB00974.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212028-1|ABB00973.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212026-1|ABB00971.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212025-1|ABB00970.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212024-1|ABB00969.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212023-1|ABB00968.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212022-1|ABB00967.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212021-1|ABB00966.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212020-1|ABB00965.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212019-1|ABB00964.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212018-1|ABB00963.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212017-1|ABB00962.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212016-1|ABB00961.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212015-1|ABB00960.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212014-1|ABB00959.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212013-1|ABB00958.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212012-1|ABB00957.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212011-1|ABB00956.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212010-1|ABB00955.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212009-1|ABB00954.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212008-1|ABB00953.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212007-1|ABB00952.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212006-1|ABB00951.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212005-1|ABB00950.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212004-1|ABB00949.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212003-1|ABB00948.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212002-1|ABB00947.1| 102|Anopheles gambiae defensin protein. 26 1.0 DQ212001-1|ABB00946.1| 102|Anopheles gambiae defensin protein. 26 1.0 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 26 1.0 DQ212042-1|ABB00987.1| 102|Anopheles gambiae defensin protein. 26 1.4 DQ212027-1|ABB00972.1| 102|Anopheles gambiae defensin protein. 26 1.4 AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related ... 25 1.8 AF063402-1|AAC18575.1| 102|Anopheles gambiae defensin protein. 25 1.8 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 25 3.1 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 25 3.1 EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle... 25 3.1 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 7.2 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -3 Query: 551 LLDQMSCDGK*CSR--CDRHGLHEGCCVGSGSKRATC 447 +L +S GK CS C R G H GC S S TC Sbjct: 14 VLSGVSAGGKYCSSDLCPRGGPHVGCNPPSSSGGPTC 50 >X93562-1|CAA63775.1| 131|Anopheles gambiae defensin protein. Length = 131 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 80 HHAALENYRAKRATCDLASGFGVGSSLCAAH 110 >DQ212041-1|ABB00986.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212040-1|ABB00985.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212039-1|ABB00984.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212038-1|ABB00983.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212037-1|ABB00982.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212036-1|ABB00981.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212035-1|ABB00980.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212034-1|ABB00979.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212033-1|ABB00978.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212032-1|ABB00977.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212031-1|ABB00976.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212030-1|ABB00975.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212029-1|ABB00974.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212028-1|ABB00973.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212026-1|ABB00971.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212025-1|ABB00970.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212024-1|ABB00969.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212023-1|ABB00968.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212022-1|ABB00967.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212021-1|ABB00966.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212020-1|ABB00965.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212019-1|ABB00964.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212018-1|ABB00963.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212017-1|ABB00962.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212016-1|ABB00961.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212015-1|ABB00960.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212014-1|ABB00959.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212013-1|ABB00958.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212012-1|ABB00957.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212011-1|ABB00956.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212010-1|ABB00955.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212009-1|ABB00954.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212008-1|ABB00953.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212007-1|ABB00952.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212006-1|ABB00951.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212005-1|ABB00950.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212004-1|ABB00949.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212003-1|ABB00948.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212002-1|ABB00947.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >DQ212001-1|ABB00946.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGSSLCAAH 81 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 26.2 bits (55), Expect = 1.0 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 116 NHQ*ASQQRRASLTLGLLYTVWVHSFHQEAVCSLSACCVYRSCII 250 N + A +A +TL L T H+FH+ + A C Y+SC + Sbjct: 101 NDRSADMIYQALVTLQHLNTHEEHNFHRRVRRQVVAECCYQSCTL 145 >DQ212042-1|ABB00987.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.4 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG+ AH Sbjct: 51 HHAALENYRAKRATCDLARGFGVGSSLCAAH 81 >DQ212027-1|ABB00972.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related 1 protein protein. Length = 178 Score = 25.4 bits (53), Expect = 1.8 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -3 Query: 551 LLDQMSCDGK*CSR--CDRHGLHEGCCVGSGSKRATC 447 +L +S G+ CS C R G H GC S S TC Sbjct: 14 VLSVVSVGGQYCSSDLCPRGGPHVGCNPPSSSGGPTC 50 >AF063402-1|AAC18575.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -3 Query: 491 HEGCCVGSGSKRATCDVGVGSDVGARSDVAH 399 H +KRATCD+ G VG AH Sbjct: 51 HHAALENYRAKRATCDLASGFGVGNNLCAAH 81 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 24.6 bits (51), Expect = 3.1 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -3 Query: 623 KTPGRAAGVSSRSGVSCGQNGC 558 + PG +++ G CG +GC Sbjct: 339 QVPGERDRIANEGGTGCGSHGC 360 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 24.6 bits (51), Expect = 3.1 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -3 Query: 623 KTPGRAAGVSSRSGVSCGQNGC 558 + PG +++ G CG +GC Sbjct: 339 QVPGERDRIANEGGTGCGSHGC 360 >EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle protein protein. Length = 178 Score = 24.6 bits (51), Expect = 3.1 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = +3 Query: 309 STSYVSSTPLISQPIAYSAHFIKKRSPQWPVSYIAPSSYITPNTYIASGPL---GATTYT 479 S+ V S+ L + AY+A +K +P + Y AP+ + + A+ + A Y Sbjct: 64 SSVRVHSSRLSNDGYAYAAPAVKYAAPAYAAHYAAPAVHYPAAAHYAAPAVHYPAAAHYA 123 Query: 480 TPFV 491 P V Sbjct: 124 APAV 127 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.4 bits (48), Expect = 7.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 509 CDRHGLHEGCCVGSGSKRATCDVGVGSDVGARS 411 C+R C + SK +T G GSD G+ S Sbjct: 1331 CERIAGETFECTSTSSKFSTSSRGSGSDSGSHS 1363 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 712,492 Number of Sequences: 2352 Number of extensions: 13608 Number of successful extensions: 79 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -