BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0661 (661 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 1.7 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 23 2.2 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 5.1 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 5.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.0 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 593 WV*LSSFLQRFCNCY 549 W+ SSF Q+F +CY Sbjct: 412 WLSCSSFFQQFFHCY 426 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 23.0 bits (47), Expect = 2.2 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 235 AKFWITLQTTCLYI 276 AKFW+ L CL++ Sbjct: 3 AKFWVNLALFCLHV 16 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 145 MDNTTTQKYWLDIQVGWGDYDSHDIERYARA 237 + TTT + D+ WG++ ++R RA Sbjct: 413 LQKTTTFMNYTDLHDLWGEFTLKALKRLERA 443 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.8 bits (44), Expect = 5.1 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = -2 Query: 246 PKFSTSISFDVVRIVITPTNLYIKPVLLCSCIVH 145 PK T+I+ + + P N PV+ C H Sbjct: 315 PKTQTNIAIATLIQSLAPLNSAANPVIYCLFSTH 348 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 359 VCNRGTSYRMHCA 321 VC G SY + CA Sbjct: 577 VCRSGLSYHLSCA 589 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,204 Number of Sequences: 336 Number of extensions: 3961 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -