BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0660 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 4.9 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 4.9 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 4.9 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 4.9 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 4.9 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 4.9 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 4.9 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 4.9 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 4.9 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 4.9 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 4.9 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 4.9 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 4.9 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 4.9 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 4.9 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 4.9 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 6.5 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 8.6 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 8.6 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 120 RHIGPLTPFPPRFIPPDMYRLRPP 143 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 120 RHIGPLTPFPPRFIPPDMYRLRPP 143 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 120 RHIGPLTPFPPRFIPPDMYRLRPP 143 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 120 RHIGPLTPFPPRFIPPDMYRLRPP 143 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 120 RHIGPLTPFPPRFIPPDMYRLRPP 143 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 120 RHIGPLTPFPPRFIPPDMYRLRPP 143 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 120 RHIGPLTPFPPRFIPPDMYRLRPP 143 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 369 RHIGPLTPFPPRFIPPDMYRLRPP 392 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 369 RHIGPLTPFPPRFIPPDMYRLRPP 392 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 369 RHIGPLTPFPPRFIPPDMYRLRPP 392 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 369 RHIGPLTPFPPRFIPPDMYRLRPP 392 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 369 RHIGPLTPFPPRFIPPDMYRLRPP 392 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 369 RHIGPLTPFPPRFIPPDMYRLRPP 392 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 368 RHIGPLTPFPPRFIPPDMYRLRPP 391 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 353 RHIGPLTPFPPRFIPPDMYRLRPP 376 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 407 RELGPR--YLKRLFGPDFDRLRPP 342 R +GP + R PD RLRPP Sbjct: 369 RHIGPLTPFPPRFIPPDMYRLRPP 392 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.8 bits (44), Expect = 6.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 634 ISEEFGNQTPTTQNFIY*IWRFY*DWLGGVSDYK 533 ISE+ GN Q + W Y D G VS YK Sbjct: 97 ISEKIGNGGRLLQPYPDWSWANYKDCSGIVSAYK 130 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 8.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 634 ISEEFGNQTPTTQNFIY*IWRFY*DWLGGVSDYK 533 ISE+ GN Q + W Y D G VS YK Sbjct: 97 ISEKIGNGGCLLQPYPDWSWANYKDCSGIVSAYK 130 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 433 NVCWLLNIRESWG 395 N+ WL+N E WG Sbjct: 282 NLKWLVNWGEQWG 294 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,459 Number of Sequences: 438 Number of extensions: 4711 Number of successful extensions: 24 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -