BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0658 (625 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021497-20|CAA16410.3| 1057|Caenorhabditis elegans Hypothetical... 29 3.6 AL021497-19|CAA16406.2| 989|Caenorhabditis elegans Hypothetical... 29 3.6 >AL021497-20|CAA16410.3| 1057|Caenorhabditis elegans Hypothetical protein Y51A2D.7b protein. Length = 1057 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +2 Query: 194 NIFPNIDYYPS-KLLQYLIILGKNCESSMCSLWSIIR*LKALS 319 ++ P I Y S + LQ++I KNC ++ SIIR L A+S Sbjct: 448 SLHPAIQLYSSGEKLQFIIDSAKNCTDNLQMTSSIIRHLHAIS 490 >AL021497-19|CAA16406.2| 989|Caenorhabditis elegans Hypothetical protein Y51A2D.7a protein. Length = 989 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +2 Query: 194 NIFPNIDYYPS-KLLQYLIILGKNCESSMCSLWSIIR*LKALS 319 ++ P I Y S + LQ++I KNC ++ SIIR L A+S Sbjct: 448 SLHPAIQLYSSGEKLQFIIDSAKNCTDNLQMTSSIIRHLHAIS 490 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,027,539 Number of Sequences: 27780 Number of extensions: 257361 Number of successful extensions: 476 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1363963182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -