BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0658 (625 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 26 0.26 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 26 0.26 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.2 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 7.4 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 26.2 bits (55), Expect = 0.26 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +2 Query: 98 IPRGRSRGQKLVVHMTVERYDSLVDFFQIYLKNIFPNIDYY 220 + +G K+++ ++FQ+ LKNI P +YY Sbjct: 106 VSAAHEKGLKIILDFVPNHTSDQHEWFQLSLKNIEPYNNYY 146 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 26.2 bits (55), Expect = 0.26 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +2 Query: 98 IPRGRSRGQKLVVHMTVERYDSLVDFFQIYLKNIFPNIDYY 220 + +G K+++ ++FQ+ LKNI P +YY Sbjct: 106 VSAAHEKGLKIILDFVPNHTSDQHEWFQLSLKNIEPYNNYY 146 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 310 SVILGVGATMTQTSSAGHAF 369 S ++ VGA TS+ GH F Sbjct: 4 SCLIFVGAAAAVTSAGGHGF 23 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 310 SVILGVGATMTQTSSAGHAF 369 S ++ VGA TS+ GH F Sbjct: 4 SCLIFVGAAAAVTSAGGHGF 23 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 7.4 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +2 Query: 83 YAKVTIPRGRSRGQKLVVHMTVERYDSLVDFFQIYLKNIF 202 Y K+ P+ + + H+TV DS+ + Y +IF Sbjct: 48 YDKMRPPKKDGQATVVYFHVTVMGLDSIDENSMTYAADIF 87 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,779 Number of Sequences: 438 Number of extensions: 3034 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -