BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0656 (642 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC800.10c |||EPS15 repeat family actin cortical patch componen... 28 1.00 SPBC26H8.01 |thi2|nmt2|thiazole biosynthetic enzyme|Schizosaccha... 27 3.0 SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 26 5.3 SPBC839.11c |hut1||uridine diphosphate-N-acetylglucosamine trans... 25 7.0 SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase Wis1|Schizosaccha... 25 9.3 SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schi... 25 9.3 >SPBC800.10c |||EPS15 repeat family actin cortical patch component |Schizosaccharomyces pombe|chr 2|||Manual Length = 1116 Score = 28.3 bits (60), Expect = 1.00 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +2 Query: 404 TSAMPRAEPSRCLLLNTLHKPRLKKDMS*CSGNTVEVSSFHSRMVRG 544 TS++P S + NTL P L + S +TV + FH+ + G Sbjct: 740 TSSVPTQHNSFDAMHNTLRSPSLNSNNSSAHASTVSRNPFHNLKISG 786 >SPBC26H8.01 |thi2|nmt2|thiazole biosynthetic enzyme|Schizosaccharomyces pombe|chr 2|||Manual Length = 328 Score = 26.6 bits (56), Expect = 3.0 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +3 Query: 372 T*W*VVTVAHGLQQCQEQSQAAAYCLILST 461 T W +V++ HGLQ C + + A+ ++ +T Sbjct: 201 TNWTLVSLNHGLQSCMDPNTINAHLVVSAT 230 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 25.8 bits (54), Expect = 5.3 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = -1 Query: 561 FQRSFLPRTIRLWNELTSTVFPEHYDMSFFKRGLWRVLSSRQRLGSALGIAEVHG 397 F++ LP+ ++ E FPE + ++ R L+ +G LG+ + HG Sbjct: 2179 FEKKILPKFPPVFYEWFVESFPEPNNWVTSRQNYCRTLAVMSIVGYVLGLGDRHG 2233 >SPBC839.11c |hut1||uridine diphosphate-N-acetylglucosamine transporter Hut1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 322 Score = 25.4 bits (53), Expect = 7.0 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 296 DKFNPFYLSTVTLSRKIFIWMIA 228 +KF L T+TL+RKIF +++ Sbjct: 257 EKFGSITLVTITLTRKIFTMLLS 279 >SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase Wis1|Schizosaccharomyces pombe|chr 2|||Manual Length = 605 Score = 25.0 bits (52), Expect = 9.3 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 525 IAGWYVAKKTSGNA-LWMTXVAPGSMDELYSGGGRCDG 635 I +Y A G+ + M + GSMD+LY+GG + +G Sbjct: 378 IVDFYGAFFVEGSVFICMEYMDAGSMDKLYAGGIKDEG 415 >SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 690 Score = 25.0 bits (52), Expect = 9.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 536 PSGYGMSSPPRCFPSTMTCPSSNEA 462 P+ Y S+PP+ P+T PSS + Sbjct: 220 PATYCPSNPPQLAPATAIAPSSQSS 244 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,756,282 Number of Sequences: 5004 Number of extensions: 56687 Number of successful extensions: 123 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -